DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and TIMM50

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001001563.2 Gene:TIMM50 / 92609 HGNCID:23656 Length:353 Species:Homo sapiens


Alignment Length:275 Identity:121/275 - (44%)
Similarity:168/275 - (61%) Gaps:14/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IVMW------------AIYKLG-KPEEDHRGPIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQ 122
            :.:|            .:|..| .|.:::...|.|||...|...|.:.|.:...:.|.:|:.||.
Human    66 VALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPT 130

  Fly   123 MARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTS 187
            ...|||:.:..||.||||:||||:..||:||:|:..||||||||||::...||.:..:||||:||
Human   131 SPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTS 195

  Fly   188 EQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDN 252
            |.|||||||:|::||:|:|.|||.|.||..::|.|.|::..||||.:||:||||......|.|.|
Human   196 ETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYN 260

  Fly   253 SLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQES 317
            .:.|..|.||.||..|.||:|||:.||.:.|.|||.||.:|...:||:..||..|.||:::.|:.
Human   261 GVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQR 325

  Fly   318 IQNLPTSERQWNLTL 332
            :..|..|.:| ||.|
Human   326 LAELSKSNKQ-NLFL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 69/126 (55%)
HIP1_clath_bdg 276..332 CDD:293123 22/55 (40%)
TIMM50NP_001001563.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..60
HAD_FCP1-like 147..262 CDD:319823 64/114 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154187
Domainoid 1 1.000 179 1.000 Domainoid score I3536
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I3057
Isobase 1 0.950 - 0.917438 Normalized mean entropy S1903
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1142452at2759
OrthoFinder 1 1.000 - - FOG0003614
OrthoInspector 1 1.000 - - otm40883
orthoMCL 1 0.900 - - OOG6_102279
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.