DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and CTDP1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_004706.3 Gene:CTDP1 / 9150 HGNCID:2498 Length:961 Species:Homo sapiens


Alignment Length:224 Identity:41/224 - (18%)
Similarity:81/224 - (36%) Gaps:46/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LVLEIKDVLVHPD------------WTYQTG-----WRFKKRPGVDYFLQQCSRNFEIVIYTSEQ 189
            |::::...|:|..            :.:|.|     ...:.||....||::.::.:|:.::|...
Human   185 LMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGS 249

  Fly   190 GMTAFPLLDALDPYGYI-KYRLVRGATDLVEGQHTKNLDYLNRDL-----SRVIVVDCDPYTTPL 248
            .:.|..:...|||...: .:|::.....:.....|.||    |:|     |.|.::|........
Human   250 RLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNL----RNLFPCGDSMVCIIDDREDVWKF 310

  Fly   249 HPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYR--QFEDPMEQFKDNQRRLQ 311
            .| |.:.:.|::       .|..|..:......:.:..|:.:.:.|  :..:|....:|      
Human   311 AP-NLITVKKYV-------YF
QGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVRD------ 361

  Fly   312 EQSQESIQNLPTSERQWNLTLLGRSLRGS 340
               .|.:...|..|....|....|.|.||
Human   362 ---PEGVTQAPGVEPSNGLEKPARELNGS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 27/145 (19%)
HIP1_clath_bdg 276..332 CDD:293123 8/57 (14%)
CTDP1NP_004706.3 Biotinyl_lipoyl_domains 21..111 CDD:299706
FCP1_euk 177..323 CDD:131304 27/149 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..589 12/69 (17%)
BRCT 636..716 CDD:237994
FCP1_C 716..961 CDD:286402
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 730..752
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.