DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and NEM1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_011867.1 Gene:NEM1 / 856393 SGDID:S000001046 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:50/215 - (23%)
Similarity:90/215 - (41%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QMAR-LLPNVVPPPYI---QPPYSLVLEIKDVLVHP---DWTY------------------QTGW 161
            :|.| |.|..:.|..:   |....||:::.:.|:|.   ..|:                  :|.:
Yeast   230 RMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLY 294

  Fly   162 RFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDAL--------------------DPYGYI 206
            ...|||..|.||.:.|:.::::|:|:.....|.|::|.|                    |..|||
Yeast   295 FIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYI 359

  Fly   207 K-YRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFD 270
            | ..:|:.:.:..:|.        :..|..||::|..|.:..::.||::.:..|:.:..|..|.:
Yeast   360 KDLSIVKDSEENGKGS--------SSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLN 416

  Fly   271 LTAFLQLIAEHQVNDVREVL 290
            |..||:  |.....|||.:|
Yeast   417 LLPFLE--AMRYSTDVRNIL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 34/168 (20%)
HIP1_clath_bdg 276..332 CDD:293123 5/15 (33%)
NEM1NP_011867.1 FCP1 9..446 CDD:227517 50/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.