DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and FCP1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_014004.1 Gene:FCP1 / 855320 SGDID:S000004890 Length:732 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:56/234 - (23%)
Similarity:84/234 - (35%) Gaps:72/234 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 MMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFE 181
            |.::..|.|      |||                |...|.|     .|.|||:..|..:.:..||
Yeast   228 MNDDGSMLR------PPP----------------VRKCWYY-----VKVRPGLKEFFAKVAPLFE 265

  Fly   182 IVIYTSEQGMTAFPLLDALDPYG-----YIKYRLVRGATDLVEGQHTKNLDYL-NRDLSRVIVVD 240
            :.|||......|..:...:||.|     .|..|...|:..      ||:|..| ..|.|.|:|:|
Yeast   266 MHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLT------TKSLAKLFPTDQSMVVVID 324

  Fly   241 --------CDPYTTPLHPDNSLVLTKWLGNDDDVQLF---DLTAFLQLIAEHQVNDVREVLRYYR 294
                    | |....:.|.|..|     |..|....|   ..|..|||        .|:..:..:
Yeast   325 DRGDVWNWC-PNLIKVVPYNFFV-----GVGDINSNFLPKQSTGMLQL--------GRKTRQKSQ 375

  Fly   295 QFEDPMEQFKDNQRRLQEQSQESIQ--------NLPTSE 325
            :.::.:....||:::|||:..:.::        .|.|:|
Yeast   376 ESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 35/140 (25%)
HIP1_clath_bdg 276..332 CDD:293123 11/58 (19%)
FCP1NP_014004.1 Biotinyl_lipoyl_domains 88..>112 CDD:416260
FCP1 150..623 CDD:227517 56/234 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.