DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and TIM50

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_175986.2 Gene:TIM50 / 842040 AraportID:AT1G55900 Length:376 Species:Arabidopsis thaliana


Alignment Length:200 Identity:72/200 - (36%)
Similarity:117/200 - (58%) Gaps:3/200 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNF 180
            |...||...:|||::.|..  |..::|||::.:.|::.||..:.|||..||||||.||:...:.:
plant   169 KGFTEPLSEKLLPDLHPAE--QHVFTLVLDLNETLLYTDWKRERGWRTFKRPGVDAFLEHLGKFY 231

  Fly   181 EIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYT 245
            |||:|:.:..|...|:.:.|||.|||:|:|.||||....|:|.::|..||||..:::.|..:.:.
plant   232 EIVVYSDQMEMYVLPVCEKLDPNGYIRYKLARGATKYENGKHYRDLSKLNRDPKKILFVSANAFE 296

  Fly   246 TPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRL 310
            :.|.|:||:.:..:....||..|.||..||:.:|.:...|:|.||..:.: :|..::|.|.....
plant   297 STLQPENSVPIKPYKLEADDTALVDLIPFLEYVARNSPADIRPVLASFER-KDIAKEFIDRSIEY 360

  Fly   311 QEQSQ 315
            |::.|
plant   361 QKRKQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 47/126 (37%)
HIP1_clath_bdg 276..332 CDD:293123 9/39 (23%)
TIM50NP_175986.2 NIF 191..338 CDD:281081 56/146 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1664
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1782
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1142452at2759
OrthoFinder 1 1.000 - - FOG0003614
OrthoInspector 1 1.000 - - otm3534
orthoMCL 1 0.900 - - OOG6_102279
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.