DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and Ublcp1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_077795.2 Gene:Ublcp1 / 79560 MGIID:1933105 Length:318 Species:Mus musculus


Alignment Length:233 Identity:47/233 - (20%)
Similarity:95/233 - (40%) Gaps:55/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IEDEFSQLPWFRQYIMRMWHTLQYYE-KMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHP 153
            ||||..::....:.::::...::.|: :::..|:..:.|              |||::...|...
Mouse   101 IEDEVVEVENREENLLKVSRRVKEYKVEVLNPPREGKKL--------------LVLDVDYTLFDH 151

  Fly   154 DWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTS-----------EQGMTA---FPLLDALDPYG 204
            ....:||... .||.:..||.....:::|||:::           |.|::.   :.:...||...
Mouse   152 RSCAETGVEL-MRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAA 215

  Fly   205 YIKYRLV-RGATD-----LVEGQ----HTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKW 259
            .|..... ||..|     ::.|:    ::|....:..|:.|..:         ::|.|.|.:..:
Mouse   216 MITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFL---------MNPQNGLKIRPF 271

  Fly   260 ----LGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYY 293
                |..|.|.:|..||.:|:.||  :::|..|:...|
Mouse   272 MKAHLNRDKDKELVKLTQYLKEIA--KLDDFLELNHKY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 30/154 (19%)
HIP1_clath_bdg 276..332 CDD:293123 5/18 (28%)
Ublcp1NP_077795.2 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 43/217 (20%)
Phosphatase. /evidence=ECO:0000250 133..294 37/184 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.