DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ublcp1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021324596.1 Gene:ublcp1 / 792145 ZFINID:ZDB-GENE-040718-3 Length:371 Species:Danio rerio


Alignment Length:244 Identity:50/244 - (20%)
Similarity:93/244 - (38%) Gaps:82/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PEED---HRGPIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYS-- 141
            ||.|   :...||:|.:::....:.:.::...::.|:  :||               :.||..  
Zfish   143 PENDDVVNDFDIEEEVTEVENREENLAKIARRVKDYK--VEE---------------LNPPRPGK 190

  Fly   142 --LVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTS-----------EQGMTA 193
              |||:|...|.......:||... .||.:..||.....:|:|||:::           |.|:|.
Zfish   191 RLLVLDIDYTLFDHKSCAETGHEL-MRPFLHEFLTSAYEDFDIVIWSATSMKWIDAKMKELGVTD 254

  Fly   194 FP------LLDA---------------LDPYGYI--KYRLVRGATDLVEGQHTKNLDYLNRDLSR 235
            .|      :||:               :.|.|.|  ||      ::....::|...|.:.|:.. 
Zfish   255 NPNYKITFMLDSAAMITVHTPKRGVVEVKPLGVIWGKY------SEFYNRKNTIMFDDIGRNFL- 312

  Fly   236 VIVVDCDPYTTPLHPDNSLVLTKW----LGNDDDVQLFDLTAFLQLIAE 280
                        ::|.|.|.:..:    |..:.|.:|:.|:.:|:.||:
Zfish   313 ------------MNPQNGLKIRPFMKAHLNREKDKELYKLSQYLKEIAK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 35/168 (21%)
HIP1_clath_bdg 276..332 CDD:293123 2/5 (40%)
ublcp1XP_021324596.1 UBQ 59..130 CDD:320785
HAD_IIID1 170..364 CDD:131299 44/217 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.