Sequence 1: | NP_610130.1 | Gene: | ttm3 / 35437 | FlyBaseID: | FBgn0032971 | Length: | 343 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598471.3 | Gene: | Ctdspl / 69274 | MGIID: | 1916524 | Length: | 276 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 55/197 - (27%) |
---|---|---|---|
Similarity: | 96/197 - (48%) | Gaps: | 26/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 MEEPQMARLLPNVVPP-PYIQPPYS--------LVLEIKDVLVHPDWTYQTGWRF---------- 163
Fly 164 -----KKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHT 223
Fly 224 KNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVRE 288
Fly 289 VL 290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ttm3 | NP_610130.1 | CPDc | 138..265 | CDD:214729 | 43/149 (29%) |
HIP1_clath_bdg | 276..332 | CDD:293123 | 3/15 (20%) | ||
Ctdspl | NP_598471.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
FCP1 | <95..270 | CDD:227517 | 50/176 (28%) | ||
HIF-SF_euk | 106..265 | CDD:274055 | 47/160 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |