DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and Ctdspl

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_598471.3 Gene:Ctdspl / 69274 MGIID:1916524 Length:276 Species:Mus musculus


Alignment Length:197 Identity:55/197 - (27%)
Similarity:96/197 - (48%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 MEEPQMARLLPNVVPP-PYIQPPYS--------LVLEIKDVLVHPDWTYQTGWRF---------- 163
            :::....:::|...|| .|:.|..:        :|:::.:.|||..:...:...|          
Mouse    76 LQKGDQRQVIPVPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTI 140

  Fly   164 -----KKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHT 223
                 .|||.||.|||:..:.||.|::|:.....|.|:.|.||.:|..:.||.|.:.....|.:.
Mouse   141 HQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYV 205

  Fly   224 KNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVRE 288
            |:|..|.|:||:||:||..|.:...||:|::.:..|..:..|.:|.||..|.:.::..  :||..
Mouse   206 KDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSRE--DDVYS 268

  Fly   289 VL 290
            :|
Mouse   269 ML 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 43/149 (29%)
HIP1_clath_bdg 276..332 CDD:293123 3/15 (20%)
CtdsplNP_598471.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
FCP1 <95..270 CDD:227517 50/176 (28%)
HIF-SF_euk 106..265 CDD:274055 47/160 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.