DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ttm3 and Ctdp1

DIOPT Version :9

Sequence 1:	NP_610130.1	Gene:	ttm3 / 35437	FlyBaseID:	FBgn0032971	Length:	343	Species:	Drosophila melanogaster
Sequence 2:	NP_080571.2	Gene:	Ctdp1 / 67655	MGIID:	1926953	Length:	960	Species:	Mus musculus

Alignment Length:	78	Identity:	15/78 - (19%)
Similarity:	34/78 - (43%)	Gaps:	17/78 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   142 LVLEIKDVLVH------PDWTYQTGWRF-----------KKRPGVDYFLQQCSRNFEIVIYTSEQ 189
            |::::...|:|      |..:.:..:.|           :.||....||::.::.:|:.::|...
Mouse   185 LMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGS 249

  Fly   190 GMTAFPLLDALDP 202
            .:.|..:...|||
Mouse   250 RLYAHTIAGFLDP 262

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ttm3	NP_610130.1	CPDc	138..265	CDD:214729	15/78 (19%)
ttm3	NP_610130.1	HIP1_clath_bdg	276..332	CDD:293123
Ctdp1	NP_080571.2	biotinyl_domain	27..111	CDD:133459
		FCP1_euk	177..323	CDD:131304	15/78 (19%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	331..580
		BRCT	637..706	CDD:237994
		FCP1_C	706..960	CDD:286402
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	770..834
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	854..948
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5190
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900