DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and Ctdnep1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_080293.1 Gene:Ctdnep1 / 67181 MGIID:1914431 Length:244 Species:Mus musculus


Alignment Length:173 Identity:50/173 - (28%)
Similarity:80/173 - (46%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LVLEIKDVLVH----------------PDWTYQT-----GWRF--KKRPGVDYFLQQCSRNFEIV 183
            |||::.:.|:|                ||:..:.     ..||  .|||.||:||:..|:.:|:|
Mouse    64 LVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELV 128

  Fly   184 IYTSEQGMTAFPLLDALD-PYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTP 247
            ::|:...:....:.|.|| ....:|.|..|....|..|.:.|:|..::.|||.::::|..|....
Mouse   129 VFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYR 193

  Fly   248 LHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVL 290
            .||||::.:..|..:..|..|.:|...|.  |.....|||.||
Mouse   194 SHPDNAIPIKSWFSDPSDTALLNLLPMLD--ALRFTAD
VRSVL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 40/146 (27%)
HIP1_clath_bdg 276..332 CDD:293123 6/15 (40%)
Ctdnep1NP_080293.1 HIF-SF_euk 61..229 CDD:274055 45/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.