DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ctdspl2a

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001071012.1 Gene:ctdspl2a / 558181 ZFINID:ZDB-GENE-061013-647 Length:469 Species:Danio rerio


Alignment Length:229 Identity:62/229 - (27%)
Similarity:106/229 - (46%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PEEDHRGPIEDEFSQL-PWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLE 145
            |.....|..|:::... |:|         .:::...:.|| |:.| .|.:.......|.:||||:
Zfish   243 PSPPAEGTYEEDWEVFDPYF---------FIKHVPPLTEE-QLTR-KPALPLKTRSTPEFSLVLD 296

  Fly   146 IKDVLVH-----------------PDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTA 193
            :.:.|||                 .|..||...|.  ||....||::.|:.:||:::|:.:.:.|
Zfish   297 LDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRL--RPFFREFLERMSQIYEIILFTASKKVYA 359

  Fly   194 FPLLDALDP-YGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLT 257
            ..||:.||| ...:::||.|.....|:|.:.|:|:.|.||||:.:::|..|........|.:.:.
Zfish   360 DKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTVIIDNSPQAFAYQLSNGIPIE 424

  Fly   258 KWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLR 291
            .|..:.:|.:|..|..||:.:.|.. .|||..:|
Zfish   425 SWFVDKNDNELLKLVPFLEKLVELN-EDVRPYIR 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 42/144 (29%)
HIP1_clath_bdg 276..332 CDD:293123 5/16 (31%)
ctdspl2aNP_001071012.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..250 1/6 (17%)
HIF-SF_euk 290..445 CDD:274055 46/156 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.