DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ctdsp1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021334687.1 Gene:ctdsp1 / 553744 ZFINID:ZDB-GENE-050522-523 Length:1222 Species:Danio rerio


Alignment Length:291 Identity:70/291 - (24%)
Similarity:114/291 - (39%) Gaps:87/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKICLNSARKTVQRCDKNYSPPKLRRIKNFYTYSVVLGSLFSIVMWAIYKLGKPEEDHRGPIEDE 93
            |.||.:..:||.::||               :|                      ||.....::|
Zfish   991 EAICKSDQKKTGEQCD---------------SY----------------------EDSESSEDEE 1018

  Fly    94 FSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLP--NVVPPPYIQPPYS--------LVLEIKD 148
            ||                       |:......:|  :.||...:.|...        :|:::.:
Zfish  1019 FS-----------------------EDCDCEICVPPTDQVPAKPLLPQIKSKDVGKICVVIDLDE 1060

  Fly   149 VLVHPDWTYQTGWRF---------------KKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLD 198
            .|||..:.......|               .|||.||.||::....||.|::|:.....|.|:.|
Zfish  1061 TLVHSSFKPVNNADFIIPVEIDGTVHQVYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVSD 1125

  Fly   199 ALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGND 263
            .||.:|..:.||.|.:.....|.:.|:|..|.|||::||:||..|.:...||||::.:..|..:.
Zfish  1126 LLDKWGAFRSRLFRESCVFHRGNYVKDLSRLGRDLNKVIIVDNSPASYIFHPDNAVPVASWFDDM 1190

  Fly   264 DDVQLFDLTAFLQLIAEHQVNDVREVLRYYR 294
            .|.:|.||..|.:.::  :|::|..||:..|
Zfish  1191 SDTELLDLIPFFERLS--KVDNVYTVLKQQR 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 43/149 (29%)
HIP1_clath_bdg 276..332 CDD:293123 5/19 (26%)
ctdsp1XP_021334687.1 HIF-SF_euk 1051..1209 CDD:274055 47/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.