Sequence 1: | NP_610130.1 | Gene: | ttm3 / 35437 | FlyBaseID: | FBgn0032971 | Length: | 343 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057480.2 | Gene: | CTDSPL2 / 51496 | HGNCID: | 26936 | Length: | 466 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 58/206 - (28%) |
---|---|---|---|
Similarity: | 95/206 - (46%) | Gaps: | 25/206 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 WHTLQYYEKMMEEPQMARLLPNVVPPPYIQ----PPYSLVLEIKDVLVH---------------- 152
Fly 153 -PDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDP-YGYIKYRLVRGAT 215
Fly 216 DLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAE 280
Fly 281 HQVNDVREVLR 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ttm3 | NP_610130.1 | CPDc | 138..265 | CDD:214729 | 43/144 (30%) |
HIP1_clath_bdg | 276..332 | CDD:293123 | 5/16 (31%) | ||
CTDSPL2 | NP_057480.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..140 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 220..240 | ||||
HIF-SF_euk | 287..448 | CDD:274055 | 48/163 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |