DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and CTDSPL2

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_057480.2 Gene:CTDSPL2 / 51496 HGNCID:26936 Length:466 Species:Homo sapiens


Alignment Length:206 Identity:58/206 - (28%)
Similarity:95/206 - (46%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 WHTLQYYEKMMEEPQMARLLPNVVPPPYIQ----PPYSLVLEIKDVLVH---------------- 152
            |.....|..:...|.:.....|..|...::    |.:||||::.:.|||                
Human   252 WEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVL 316

  Fly   153 -PDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDP-YGYIKYRLVRGAT 215
             .|..||...|.  ||....||::.|:.:||:::|:.:.:.|..||:.||| ...:::||.|...
Human   317 FQDVIYQVYVRL--RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHC 379

  Fly   216 DLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAE 280
            ..|:|.:.|:|:.|.||||:.|::|..|........|.:.:..|..:.:|.:|..|..||:.:.|
Human   380 VCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVE 444

  Fly   281 HQVNDVREVLR 291
            .. .|||..:|
Human   445 LN-EDVRPHIR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 43/144 (30%)
HIP1_clath_bdg 276..332 CDD:293123 5/16 (31%)
CTDSPL2NP_057480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..240
HIF-SF_euk 287..448 CDD:274055 48/163 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.