DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ctdnep1a

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001007310.1 Gene:ctdnep1a / 492343 ZFINID:ZDB-GENE-041114-177 Length:245 Species:Danio rerio


Alignment Length:173 Identity:51/173 - (29%)
Similarity:82/173 - (47%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LVLEIKDVLVH----------------PDWTYQT-----GWRF--KKRPGVDYFLQQCSRNFEIV 183
            |||::.:.|:|                ||:..:.     ..||  .|||.||:||:..|:.:|:|
Zfish    65 LVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELV 129

  Fly   184 IYTSEQGMTAFPLLDALD-PYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTP 247
            ::|:...:....:.|.|| ..|.:|.|..|....|..|.:.|:|..::.|||.::::|..|....
Zfish   130 VFTASMEIYGSAVADKLDNNRGILKRRYYRQHCTLDLGSYIKDLSVVHSDLSSIVILDNSPGAYR 194

  Fly   248 LHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVL 290
            .||||::.:..|..:..|..|.:|...|.  |....:|||.||
Zfish   195 SHPDNAIPIKSWFSDPSDTALLNLLPMLD--ALRFTSD
VRSVL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 41/146 (28%)
HIP1_clath_bdg 276..332 CDD:293123 6/15 (40%)
ctdnep1aNP_001007310.1 HIF-SF_euk 62..230 CDD:274055 46/166 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.