DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ctdsp2

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001006793.1 Gene:ctdsp2 / 448497 XenbaseID:XB-GENE-951111 Length:271 Species:Xenopus tropicalis


Alignment Length:242 Identity:62/242 - (25%)
Similarity:111/242 - (45%) Gaps:38/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SPPKLRRIKNFYTYSVVLGSLFSIVMWAIYKLGKPEEDHRGPI-EDEFSQLPWFRQYIMRMWHTL 111
            |.||..|.::.:.      :||..:  :...:.:|......|| ::|.:..|  :..:::   .|
 Frog    27 SSPKKPRSRSIFK------ALFCCL--SAQNVSRPAGSIEPPIPKEETNATP--KSDLLQ---CL 78

  Fly   112 QYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDW-----------------TYQT 159
            ||  :..:.|..: |||.|.|..  :....:|:::.:.|||..:                 |:|.
 Frog    79 QY--QFYQIPGTS-LLPEVAPKD--KEKICMVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQV 138

  Fly   160 GWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTK 224
              ...|||.||.||::..:.:|.|::|:.....|.|:.|.||..|..:.||.|.|....:|.:.|
 Frog   139 --YVLKRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVK 201

  Fly   225 NLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDL 271
            :|..|.|||.:.:::|..|.:...||:|::.:..|..:..|.:|..|
 Frog   202 DLSRLGRDLKKTVILDNSPASYIFHPENAVPVQSWFDDMSDTELLSL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 39/143 (27%)
HIP1_clath_bdg 276..332 CDD:293123
ctdsp2NP_001006793.1 HIF-SF_euk 101..260 CDD:274055 42/150 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.