DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and Ublcp1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster


Alignment Length:286 Identity:60/286 - (20%)
Similarity:106/286 - (37%) Gaps:63/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RKTVQRCDKNYSPPKLRRIK--------NFYTYSVVLGSLFSIVMWAIYKLGKPE---------E 84
            |||..|.::.    ||..:|        |....::.|...|.::|     :|..|         .
  Fly    36 RKTQVRPERQ----KLLNLKYKGKTAADNVKISALELKPNFKLMM-----VGSTEADIEDACSLP 91

  Fly    85 DHRGPIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDV 149
            |:.|.:.|:|.......:.:.   |:..|..|:....:..: :..:.||.  :....|||:|...
  Fly    92 DNIGEVVDDFDDADEREESVE---HSAVYLAKVQRRVRDYK-IKELAPPR--EGKKLLVLDIDYT 150

  Fly   150 LVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTS------EQGMTA--------FPLLDAL 200
            |.......:||... .||.:..||.....:::|||:::      |:.|..        :.::..|
  Fly   151 LFDHRSPAETGTEL-MRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYL 214

  Fly   201 DPYGYIKYRL-VRGATDLVEGQHTKNLD-----YLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKW 259
            |....|...: .||..|:      |.|.     |...:.|..|:.|.......::|.:.|.:..:
  Fly   215 DSTAMISVHVPERGVVDV------KPLGVIWALYKQYNSSNTIMFDDIRRNFLMNPKSGLKIRPF 273

  Fly   260 ----LGNDDDVQLFDLTAFLQLIAEH 281
                |....|.:|..|:.:|:.||.|
  Fly   274 RQAHLNRGTDTELLKLSDYLRKIAHH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 31/150 (21%)
HIP1_clath_bdg 276..332 CDD:293123 3/6 (50%)
Ublcp1NP_651118.1 UBP_N 12..79 CDD:176408 11/51 (22%)
UBQ 14..79 CDD:214563 11/51 (22%)
HAD_IIID1 120..314 CDD:131299 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.