DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and hzg

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster


Alignment Length:236 Identity:63/236 - (26%)
Similarity:101/236 - (42%) Gaps:55/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 NVVPPP------YIQPPYSL--------VLEIKDVLVHPDWTYQTGWRFK--------------- 164
            :..|||      |:.|...|        |:::.:.|||..        ||               
  Fly    88 STTPPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETLVHSS--------FKPIPNADFIVPVEIDG 144

  Fly   165 --------KRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQ 221
                    |||.||.|||:....:|.|::|:.....|.|:.|.||.:...:.||.|.:.....|.
  Fly   145 TVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGN 209

  Fly   222 HTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDV 286
            :.|:|:.|.|||.::::||..|.:...||||::.:..|..:..|.:|.:|....:.::  :|:.|
  Fly   210 YIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLS--KVDSV 272

  Fly   287 REVLRYYRQFEDPMEQFKDNQRRLQEQSQESIQNLPTSERQ 327
            ..||....|   |:    :||...|:..|| :|..|....|
  Fly   273 YSVLCNSNQ---PL----NNQTNQQQHPQE-LQQAPNQLHQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 42/157 (27%)
HIP1_clath_bdg 276..332 CDD:293123 14/52 (27%)
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.