DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and timm50

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_956959.1 Gene:timm50 / 393638 ZFINID:ZDB-GENE-040426-1618 Length:387 Species:Danio rerio


Alignment Length:275 Identity:129/275 - (46%)
Similarity:174/275 - (63%) Gaps:9/275 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LGSLFSIVMWAIYKLGKPEEDHRG-PIEDEF-SQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLL 127
            ||....||    |..|....|.:| .|.||| :.:|..:| :.|.:...:.|.:|:.||...:||
Zfish   111 LGGTVGIV----YIFGSNSVDEQGNKIPDEFDNDVPVIQQ-LRRTFKYFKDYRQMIIEPTSPKLL 170

  Fly   128 PNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMT 192
            |:.:..||.||||:||||:.|||:||:|:..||||||||||:||..||.:..:||||:|||.|||
Zfish   171 PDPLREPYYQPPYTLVLELTDVLLHPEWSLATGWRFKKRPGIDYLFQQLAPLYEIVIFTSETGMT 235

  Fly   193 AFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLT 257
            |:||:|::||.|::.|||.|.||..:||.|.|::..||||.|:||||||......|.|.|.|.|.
Zfish   236 AYPLIDSIDPQGFVMYRLFRDATRYMEGHHVKDVSCLNRDTSKVIVVDCKREAFGLQPFNGLALC 300

  Fly   258 KWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQESIQNLP 322
            ||.||.:|..|:||.|||:.||...|.|||.||..|...|||:|.||..|.:|..:.::.|..:.
Zfish   301 KWDGNSEDRTLYDLAAFLKTIATSGVEDVRSVLENYAHEEDPIEAFKRRQAQLAREEEQRISEMA 365

  Fly   323 TSERQ-WNL-TLLGR 335
            ..::| ::| |:.||
Zfish   366 QQKKQGFSLGTIAGR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 74/126 (59%)
HIP1_clath_bdg 276..332 CDD:293123 20/57 (35%)
timm50NP_956959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..93
NIF 183..330 CDD:281081 83/146 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589342
Domainoid 1 1.000 183 1.000 Domainoid score I3366
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2930
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1142452at2759
OrthoFinder 1 1.000 - - FOG0003614
OrthoInspector 1 1.000 - - otm26612
orthoMCL 1 0.900 - - OOG6_102279
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.