DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and Dd

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster


Alignment Length:174 Identity:49/174 - (28%)
Similarity:78/174 - (44%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SLVLEIKDVLVH------PDWTYQTGW---------------RF--KKRPGVDYFLQQCSRNFEI 182
            :|||::.:.|:|      |..|.:.|.               ||  .|||.|||||...|:.:::
  Fly    62 TLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDL 126

  Fly   183 VIYTSEQGMTAFPLLDALD-PYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTT 246
            |::|:...:....:.|.|| ....::.|..|.......|.:||:|..:..||:|:.::|..|...
  Fly   127 VVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAY 191

  Fly   247 PLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVL 290
            ...|:|::.:..|..:..|..|..|...|.  |....||||.||
  Fly   192 RCFPNNAIPIKSWFSDPMDTALLSLLPMLD--ALRFTND
VRSVL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 38/147 (26%)
HIP1_clath_bdg 276..332 CDD:293123 7/15 (47%)
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.