DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ttm50

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster


Alignment Length:280 Identity:166/280 - (59%)
Similarity:215/280 - (76%) Gaps:5/280 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YSVVLGSLFSIVMWAIYKLGKPEEDHRG-PIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMA 124
            :::..||..:...||:|:.||||.|..| ||||||:..|..:||:.|||.::.||::|::||..|
  Fly   149 FAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRA 213

  Fly   125 RLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQ 189
            :|||:.:.|||:||.|:||||:||||||||||||||||||||||||:||.:|:::||||::|:||
  Fly   214 KLLPDPLKPPYVQPRYTLVLEMKDVLVHPDWTYQTGWRFKKRPGVDHFLAECAKDFEIVVFTAEQ 278

  Fly   190 GMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSL 254
            |||.||:||||||.|||.|||||.||..|:|.|.||||.|||||.:|||||.|...|.:||||:.
  Fly   279 GMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTF 343

  Fly   255 VLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQ--SQES 317
            .|.:|.|||||.||.||.|||::||::.|:||||||.|||||:||:.||::|||:|.||  ..|.
  Fly   344 GLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYRQFDDPINQFRENQRKLAEQMLEAER 408

  Fly   318 IQNLPTSE--RQWNLTLLGR 335
            |:...|..  :||:..:|||
  Fly   409 IEQSKTKPMVKQWSRNILGR 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 89/126 (71%)
HIP1_clath_bdg 276..332 CDD:293123 29/59 (49%)
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 90/127 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459143
Domainoid 1 1.000 132 1.000 Domainoid score I1664
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1782
Isobase 1 0.950 - 0.917438 Normalized mean entropy S1903
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1142452at2759
OrthoFinder 1 1.000 - - FOG0003614
OrthoInspector 1 1.000 - - otm26612
orthoMCL 1 0.900 - - OOG6_102279
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2489
1211.750

Return to query results.
Submit another query.