DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and Ctdspl

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001382669.1 Gene:Ctdspl / 301056 RGDID:1304841 Length:276 Species:Rattus norvegicus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:112/281 - (39%) Gaps:83/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IYKLGKPEEDH-RGPIEDE------------------FSQLPWFRQYIMRMWHTLQYYEKMMEEP 121
            |.::..|:||. |.|:..|                  .|....||.|             .:|.|
  Rat     7 ITQVTNPKEDEARSPVAGEKASQRNISLKKQRGRSILSSFFCCFRDY-------------NVEPP 58

  Fly   122 QMARLLPNVVPP-----------------PYIQPP--YSL-------------VLEIKDVLVHPD 154
            ..:.  |:|:||                 |...||  |.|             |:::.:.|||..
  Rat    59 PPSS--PSVLPPLVEENGGLQKGDQRQVIPVPSPPAKYLLPEVTVLDHGKKCVVIDLDETLVHSS 121

  Fly   155 WTYQTGWRF---------------KKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYG 204
            :...:...|               .|||.||.|||:..:.||.|::|:.....|.|:.|.||.:|
  Rat   122 FKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWG 186

  Fly   205 YIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLF 269
            ..:.||.|.:.....|.:.|:|..|.|:||:||:||..|.:...||:|::.:..|..:..|.:|.
  Rat   187 VFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELL 251

  Fly   270 DLTAFLQLIAEHQVNDVREVL 290
            ||..|.:.::..  :||..:|
  Rat   252 DLIPFFEGLSRE--DDVYRML 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 46/156 (29%)
HIP1_clath_bdg 276..332 CDD:293123 3/15 (20%)
CtdsplNP_001382669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.