DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and tim50

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_595583.2 Gene:tim50 / 2539802 PomBaseID:SPBC17A3.01c Length:452 Species:Schizosaccharomyces pombe


Alignment Length:264 Identity:97/264 - (36%)
Similarity:143/264 - (54%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GPIEDE---------FSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLV 143
            ||.|.|         :|...|:.:...|..:...||    :||...:|||:.:|.|| ..||:||
pombe   121 GPDEKELEKQYPAAGYSPSDWWNRVKARTNNFFSYY----QEPAFEKLLPDPLPEPY-NRPYTLV 180

  Fly   144 LEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGY-IK 207
            |.:.|:|:|.:||.|.|||..||||:||||...|..:|:||:|.:...||.|::|.:|||.. |.
pombe   181 LSLDDLLIHSEWTRQHGWRTAKRPGLDYFLGYLSMYYEVVIFTRQYLATAKPIIDKIDPYHVSIS 245

  Fly   208 YRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLT 272
            ..|.|.::...:|:..|:|.||||||||||::|.:|.:....|||::.:..|.||..|.:|..|.
pombe   246 AVLTRESSKYEKGKVIKDLSYLNRDLSRVIMIDTNPESWSKQPDNAIAMAPWTGNPKDKELVGLI 310

  Fly   273 AFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQESIQNLPTSERQWNLTLLGRSL 337
            ..|:.||...:.|||.||:.|:....|:|.    .||.::...:.|::       ||    .:..
pombe   311 PLLEFIAIMDIKDVRPVLKSYQGKNIPLEY----ARREEKLRTKLIED-------WN----EKKK 360

  Fly   338 RGSS 341
            :|||
pombe   361 KGSS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 58/127 (46%)
HIP1_clath_bdg 276..332 CDD:293123 15/55 (27%)
tim50NP_595583.2 NIF 177..325 CDD:281081 64/147 (44%)
FCP1 <238..452 CDD:227517 49/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 130 1.000 Domainoid score I1326
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130620
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003614
OrthoInspector 1 1.000 - - otm47159
orthoMCL 1 0.900 - - OOG6_102279
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2489
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.