DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and cnep-1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001254123.1 Gene:cnep-1 / 185802 WormBaseID:WBGene00018474 Length:276 Species:Caenorhabditis elegans


Alignment Length:173 Identity:48/173 - (27%)
Similarity:80/173 - (46%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LVLEIKDVLVH----------------PDWT-------YQTGWRFKKRPGVDYFLQQCSRNFEIV 183
            |||::.:.|:|                .|:|       :...:...:||.|||||...|:.:|:|
 Worm    90 LVLDLDETLIHSHHDGVLRQTVKPGTPSDFTIRVVIDRHPVKFSVHERPHVDYFLSVVSQWYELV 154

  Fly   184 IYTSEQGMTAFPLLDALD-PYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTP 247
            ::|:...:....:.|.|| ..|.:|.|..|....:..|.:||:|..::.|||.:.::|..|....
 Worm   155 VFTASMEVYGTSVADRLDRGRGILKRRYFRQHCTMEVGGYTKDLSAIHPDLSSICILDNSPGAYR 219

  Fly   248 LHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVL 290
            ..|.|::.:..|..:.:|..|.:|..||.  |....:|||.||
 Worm   220 KFPHNAIPIPSWFSDPNDTCLLNLLPFLD--ALRFTSD
VRSVL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 37/146 (25%)
HIP1_clath_bdg 276..332 CDD:293123 6/15 (40%)
cnep-1NP_001254123.1 HIF-SF_euk 87..255 CDD:274055 43/166 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.