DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and scpl-1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_740912.2 Gene:scpl-1 / 181944 WormBaseID:WBGene00007054 Length:491 Species:Caenorhabditis elegans


Alignment Length:212 Identity:59/212 - (27%)
Similarity:98/212 - (46%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 YEKMM--------EEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVH--------PDWTYQT--- 159
            |:|:.        |:|    |||.::|..  .....||:::.:.|||        ||:....   
 Worm   284 YDKIANDSVGTINEKP----LLPPLLPQD--SNKKCLVIDLDETLVHSSFKPVKNPDFVIPVEID 342

  Fly   160 GWRFK----KRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEG 220
            |...:    |||.||.||.:...:||.:::|:.....|.|:.|.||.....:.||.|.|....:|
 Worm   343 GVEHQVYVLKRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKG 407

  Fly   221 QHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVND 285
            .:.|:|..|.|:|::.:::|..|.:...||:|::.:|.|..:..|.:|.|:...|    || :|.
 Worm   408 NYVKDLSRLGRNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSL----EH-LNG 467

  Fly   286 VREVLRYYRQFEDPMEQ 302
            ...:...||..|.|..:
 Worm   468 FSSIYDLYRPEEGPQSE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 40/141 (28%)
HIP1_clath_bdg 276..332 CDD:293123 7/27 (26%)
scpl-1NP_740912.2 HIF-SF_euk 311..465 CDD:274055 46/158 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.