DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and fcp-1

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_492423.2 Gene:fcp-1 / 172719 WormBaseID:WBGene00009479 Length:659 Species:Caenorhabditis elegans


Alignment Length:173 Identity:41/173 - (23%)
Similarity:63/173 - (36%) Gaps:37/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HPDWT--------YQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKY 208
            |.|.|        |.|    |.||....||.:.|..:|:.|.|..|...|..:...|||...:..
 Worm   169 HKDITKYNLHSRVYTT----KLRPHTTEFLNKMSNMYEMHIVTYGQRQYAHRIAQILDPDARLFE 229

  Fly   209 RLVRGATDLVEGQH-TKNLDYL---NRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLF 269
            :.:....:|...|| |.||..|   ..:|  |:::|          |.|.|   |:.::..:|:.
 Worm   230 QRILSRDELFSAQHKTNNLKALFPCGDNL--VVIID----------DRSDV---WMYSEALIQIK 279

  Fly   270 DLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQE 312
            ....|      .:|.|:........|....:|......:.|:|
 Worm   280 PYRFF------KEVGDINAPKNSKEQMPVQIEDDAHEDKVLEE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 33/124 (27%)
HIP1_clath_bdg 276..332 CDD:293123 6/37 (16%)
fcp-1NP_492423.2 HAD_like 138..284 CDD:328728 34/133 (26%)
BRCT 358..431 CDD:237994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.