DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ctdspl

DIOPT Version :10

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_031759361.1 Gene:ctdspl / 100487887 XenbaseID:XB-GENE-1013061 Length:276 Species:Xenopus tropicalis


Alignment Length:45 Identity:12/45 - (26%)
Similarity:21/45 - (46%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GESKPDID----MEATPTTTTTDDQGSLSLIEKWLFDDQGLVQCD 234
            |...|||.    :|..|:|......|::..|.....:|:|:.:|:
 Frog   267 GNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 12/45 (27%)
ctdsplXP_031759361.1 HIF-SF_euk 106..264 CDD:274055
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.