DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and ctdspl

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_031759361.1 Gene:ctdspl / 100487887 XenbaseID:XB-GENE-1013061 Length:276 Species:Xenopus tropicalis


Alignment Length:294 Identity:74/294 - (25%)
Similarity:120/294 - (40%) Gaps:82/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TCLLSPCEKICLNSARKTVQRCDKNYSPPKLRRIKNFYTYSVVLGSLFSIVMWAIYKLGKPEEDH 86
            |.:.:|.|:..|:.|::.|.:|  |.|   |::.:|...:|    |||  ..:..|.:..|..::
 Frog     8 TQVSNPKEEGILSCAQEKVSQC--NIS---LKKQRNRSIFS----SLF--CCFRSYSVEPPTSNN 61

  Fly    87 RGPIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEE--------PQMARLLPNVVPPPYIQPPYS-- 141
            ..      |.||                 .::||        ...|..:|: .|..|:.|...  
 Frog    62 NS------SPLP-----------------PLVEENGGIQKADQTQALTIPS-PPAKYLLPELKVS 102

  Fly   142 ------LVLEIKDVLVHPDWTYQTGWRFK-----------------------KRPGVDYFLQQCS 177
                  :|:::.:.|||..        ||                       |||.||.|||:..
 Frog   103 DYGKKCVVIDLDETLVHSS--------FKPINNADFIVPVEIDGTIHQVYVLKRPHVDEFLQKMG 159

  Fly   178 RNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCD 242
            ..||.|::|:.....|.|:.|.||.:|....||.|.:.....|.:.|:|..|.|:||:||::|..
 Frog   160 ELFECVLFTASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVKDLSRLGRELSKVIIIDNS 224

  Fly   243 PYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQ 276
            |.:...||:|::.:..|..:..|.:|.||..|.:
 Frog   225 PASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 43/157 (27%)
HIP1_clath_bdg 276..332 CDD:293123 0/1 (0%)
ctdsplXP_031759361.1 HIF-SF_euk 106..264 CDD:274055 47/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.