DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm3 and timm50

DIOPT Version :9

Sequence 1:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001120038.1 Gene:timm50 / 100145004 XenbaseID:XB-GENE-963112 Length:368 Species:Xenopus tropicalis


Alignment Length:268 Identity:120/268 - (44%)
Similarity:166/268 - (61%) Gaps:8/268 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GSLFSIVMWAIYKLGKPEEDHRG-PIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPN 129
            |||       :|..|....|.:| .|.|||...|...|.|.|.:.....|.:|:.||...:|||:
 Frog    94 GSL-------VYIFGSNSVDEQGNKIPDEFDSDPPVVQQIRRTYKYFIDYRQMIIEPTSPKLLPD 151

  Fly   130 VVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAF 194
            .:..||.||||:||||:.|||:||:|:..||||||||.|:|...||.:..:||||:|||.|:|||
 Frog   152 PLKEPYYQPPYTLVLELTDVLLHPEWSLSTGWRFKKRAGIDNLFQQLAPLYEIVIFTSETGLTAF 216

  Fly   195 PLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKW 259
            ||:|.:||:|::.|||.|.||...:|.|.|::..||||.|.|::|||......|.|.|.|.:.||
 Frog   217 PLIDNVDPHGFVSYRLFRDATRYTDGHHVKDISCLNRDPSHVVIVDCKREAFKLQPYNGLAIKKW 281

  Fly   260 LGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQESIQNLPTS 324
            .|:.:|..|:||||||:.||...|:|||.||..|...|||:|.||..|.:|:::.|:.:.::...
 Frog   282 DGSSEDRALYDLTAFLKTIAVSGVSDVRSVLENYALEEDPLEAFKRRQTQLEQEEQQRLADMSQL 346

  Fly   325 ERQWNLTL 332
            .::..|:|
 Frog   347 SKRQTLSL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm3NP_610130.1 CPDc 138..265 CDD:214729 67/126 (53%)
HIP1_clath_bdg 276..332 CDD:293123 19/55 (35%)
timm50NP_001120038.1 LPLAT <64..>128 CDD:388412 14/40 (35%)
HAD_FCP1-like 161..278 CDD:319823 63/116 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3648
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3026
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1142452at2759
OrthoFinder 1 1.000 - - FOG0003614
OrthoInspector 1 1.000 - - otm48079
Panther 1 1.100 - - O PTHR12210
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.