DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2528 and LOC101886774

DIOPT Version :9

Sequence 1:NP_610129.3 Gene:CG2528 / 35435 FlyBaseID:FBgn0032969 Length:731 Species:Drosophila melanogaster
Sequence 2:XP_005174677.3 Gene:LOC101886774 / 101886774 -ID:- Length:257 Species:Danio rerio


Alignment Length:257 Identity:139/257 - (54%)
Similarity:178/257 - (69%) Gaps:7/257 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 MFIVQR---KRDIAEPRPCLLYGYGGFNYSLMPSFGILSLMFMDTFDGVLAFPNLRGGGEYGMEW 534
            ||:|.:   |:|  ...|..|||||||.:|:.|.:....|:|:....|:||..|:|||||||..|
Zfish     1 MFLVHQRGIKKD--GSHPVFLYGYGGFEHSIQPHYNTAYLLFIRHLGGILAIANIRGGGEYGQTW 63

  Fly   535 HNGGRMLSKQNVFNDFQAAAEFLTKNNYTTKDRLAIQGASNGGLLVGACINQRPDLFGAAVAQVG 599
            |..|.:.:|||.|:|||:|||:|.:.|:|:..|:||.|||||||||.||:||||:|||.||.:||
Zfish    64 HKAGTLGNKQNCFDDFQSAAEYLIQQNFTSASRIAINGASNGGLLVAACVNQRPELFGCAVMEVG 128

  Fly   600 VMDMLRFHKFTIGHAWCSDYGNPDEKVHFANLIKFSPLHNVHIPLNPNQEYPSTLILTADHDDRV 664
            |||||:||||||||||.:|||..|:...|..|||:|||||  :|......:|:.|:|||||||||
Zfish   129 VMDMLKFHKFTIGHAWTTDYGCSDDPEQFQWLIKYSPLHN--LPQCNGPVFPALLLLTADHDDRV 191

  Fly   665 SPLHSYKFVAALQEAVRYSEYQLNPILLRVYTKAGHGAGKPTKMRISEATDIITFFKKTLNV 726
            .|||:.|:||.:|..|..:..|..|:|:||.||:||||||||...|.|.|.|.:|...||.:
Zfish   192 VPLHTLKYVATVQHTVGRNPAQKQPLLVRVDTKSGHGAGKPTAKAILEDTHIFSFIAHTLGL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2528NP_610129.3 Peptidase_S9_N 28..442 CDD:280970
Peptidase_S9 516..727 CDD:278741 122/211 (58%)
LOC101886774XP_005174677.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217404at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.