DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11634 and ALDH3H1

DIOPT Version :10

Sequence 1:NP_610128.2 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_175081.1 Gene:ALDH3H1 / 841020 AraportID:AT1G44170 Length:484 Species:Arabidopsis thaliana


Alignment Length:65 Identity:16/65 - (24%)
Similarity:29/65 - (44%) Gaps:8/65 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LSPILKPHKAQKNYVVVEN------GFHF-ETLRIYDNFKAIVFPIGGQILPDIEDHKEEHAAIF 294
            |.|||..:..::::.|:.:      .:.| ...::.:.|.|.| ..||.::.||..|...|...|
plant   352 LLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATV-SAGGIVVNDIAVHLALHTLPF 415

  Fly   295  294
            plant   416  415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11634NP_610128.2 DUF1487 64..279 CDD:254173 11/48 (23%)
ALDH3H1NP_175081.1 PLN02174 1..484 CDD:177831 16/65 (25%)

Return to query results.
Submit another query.