DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11629 and Pelp1

DIOPT Version :9

Sequence 1:	NP_610125.1	Gene:	CG11629 / 35431	FlyBaseID:	FBgn0032965	Length:	463	Species:	Drosophila melanogaster
Sequence 2:	NP_083507.3	Gene:	Pelp1 / 75273	MGIID:	1922523	Length:	1123	Species:	Mus musculus

Alignment Length:	134	Identity:	25/134 - (18%)
Similarity:	48/134 - (35%)	Gaps:	43/134 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   102 LHTLTLQNFSEILHPAETETLSP-------SCRVPFVNC--------GACEN------FMRIFDT 145
            |..|.|::.|.:|.|.....::|       :..:|.:.|        |..:|      .:.:.:.
Mouse    33 LRLLLLESISGLLQPRTASPVAPVHPPIQWAPHLPGLMCLLRLHGTAGGAQNLSALGALVNLSNA 97

  Fly   146 H-GNVRSR------------------LSQDSLQLLMSAVQTVLKQSPPTELRAFDAGVSGLRGTL 191
            | |::::|                  ..|..:..|.|..|.:..|..|:.:   :..|:.||..|
Mouse    98 HLGSIKTRFEGLCLLSLLIGESPTELFQQHCVSWLRSIQQVLQSQDSPSTM---ELAVAVLRDLL 159

  Fly   192 KRDS 195
            :..|
Mouse   160 RHAS 163

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11629	NP_610125.1	DUF4778	70..333	CDD:292627	25/134 (19%)
Pelp1	NP_083507.3	Required for modulation of ESR1 transcriptional activity. /evidence=ECO:0000250\|UniProtKB:Q8IZL8	2..80		9/46 (20%)
		LXXLL motif 1	33..37		1/3 (33%)
		LXXLL motif 2	69..73		1/3 (33%)
		RIX1	83..232	CDD:285390	15/84 (18%)
		LXXLL motif 3	111..115		0/3 (0%)
		Required for modulation of ESR1 transcriptional activity. /evidence=ECO:0000250\|UniProtKB:Q8IZL8	121..189		11/46 (24%)
		LXXLL motif 4	155..159		2/3 (67%)
		LXXLL motif 5	177..181
		LXXLL motif 6	264..268
		LXXLL motif 7	271..275
		LXXLL motif 8	365..369
		NUC202	424..475	CDD:149302
		LXXLL motif 9	460..464
		LXXLL motif 10	580..584
		LXXLL motif 11	585..589
		NUC202	<609..>638	CDD:149302
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	639..767
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	779..1123
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28I3T
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900