Sequence 1: | NP_610125.1 | Gene: | CG11629 / 35431 | FlyBaseID: | FBgn0032965 | Length: | 463 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001339018.3 | Gene: | pelp1 / 100003680 | ZFINID: | ZDB-GENE-140106-164 | Length: | 1212 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 53/250 - (21%) |
---|---|---|---|
Similarity: | 79/250 - (31%) | Gaps: | 87/250 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLSLRNGIFAGNLLGSGFCLQRFAPCACRSSRKPPAGNSPKNPYKQLNNDSVEEKRLSVLMELGC 65
Fly 66 RCPQK--------------SHKERWFLTNQ-RIILALATT-----------------------LN 92
Fly 93 RPP-DLVSDFL----------------HTLTLQNFSEILHPAETETLSPSCRVPFVNC------- 133
Fly 134 GACENFMRIFDTHGNVRSRLSQDSLQLLMSAVQTV---LKQSPPTELRAFDAGVS 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11629 | NP_610125.1 | DUF4778 | 70..333 | CDD:292627 | 35/180 (19%) |
pelp1 | XP_001339018.3 | RIX1 | 19..194 | CDD:285390 | 13/52 (25%) |
NUC202 | 391..446 | CDD:149302 | |||
Asp-B-Hydro_N | <979..1142 | CDD:191249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28I3T | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |