DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11629 and pelp1

DIOPT Version :9

Sequence 1:NP_610125.1 Gene:CG11629 / 35431 FlyBaseID:FBgn0032965 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_001339018.3 Gene:pelp1 / 100003680 ZFINID:ZDB-GENE-140106-164 Length:1212 Species:Danio rerio


Alignment Length:250 Identity:53/250 - (21%)
Similarity:79/250 - (31%) Gaps:87/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSLRNGIFAGNLLGSGFCLQRFAPCACRSSRKPPAGNSPKNPYKQLNNDSVEEKRLSVLMELGC 65
            :|||::......:.|...|: .:.|.||.|.|:      ....|.....||...|    :.|:.|
Zfish   148 LLSLKSECHLAAMKGMMACM-TYYPRACGSLRE------KLGAYFLSKMDSDNPK----VQEVAC 201

  Fly    66 RCPQK--------------SHKERWFLTNQ-RIILALATT-----------------------LN 92
            .|..:              ...|.|  ||| ..:||.|.:                       |.
Zfish   202 ECYGRLPCLGGVLERGGGGRRAEGW--TNQLHCLLASANSILGQLYHGAETEGTVQYEGPGVELP 264

  Fly    93 RPP-DLVSDFL----------------HTLTLQNFSEILHPAETETLSPSCRVPFVNC------- 133
            .|| |.|...|                |||::...|.:..|.: ..|:..||...||.       
Zfish   265 FPPLDDVDPLLILQLQHRYKAVTLAMKHTLSVDPASSVRLPVQ-HVLNLLCRALAVNTKSISPTG 328

  Fly   134 GACENFMRIFDTHGNVRSRLSQDSLQLLMSAVQTV---LKQSPPTELRAFDAGVS 185
            ..|:..:.:...|        .|:|:||.:.::.|   |.|......|.|...:|
Zfish   329 DGCQKLLVLPSIH--------NDTLELLSALIKAVGGGLVQYSSVLTRLFSQSLS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11629NP_610125.1 DUF4778 70..333 CDD:292627 35/180 (19%)
pelp1XP_001339018.3 RIX1 19..194 CDD:285390 13/52 (25%)
NUC202 391..446 CDD:149302
Asp-B-Hydro_N <979..1142 CDD:191249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28I3T
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.