DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and Sry-delta

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:516 Identity:110/516 - (21%)
Similarity:179/516 - (34%) Gaps:167/516 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 CSFC----QFNSNTNNSMLLHLLD----SSHKEVLLALNRSVPICIAQRRRIQ-----CSRCGME 498
            |.||    ..::.:::||....|.    ||.|.|.|.|.. :..||..:..::     |.||..|
  Fly     4 CFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTH-LANCIQTQLDLKPGARLCPRCFQE 67

  Fly   499 ------FLYNIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHKHHLAR 557
                  .:.|:...|..:|..    |.|....|::       ...|.:..|..:           
  Fly    68 LSDYDTIMVNLMTTQKRLTTQ----LKGALKSEFE-------VPESGEDILVEE----------- 110

  Fly   558 YFCAICRLEFDNSLDARRHRSLV-IHKQKARPQTSI-----PQPENEIEHMLREVLEETV----- 611
              ..|.:.:.:...||......| :.|.:....|.|     .:.|.|.:....|.:.|.|     
  Fly   111 --VEIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDS 173

  Fly   612 -----------PSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSD-NHLCLSCGISFESA 664
                       ..|..||   |..:|:...|...|..:|.:|.:|.||.. ||:|..||:     
  Fly   174 EALYGKSSDGEDRPTKKR---VKQECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGV----- 230

  Fly   665 QALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVL 729
                                               .|...:|   |..|...|.     ||.| .
  Fly   231 -----------------------------------IRRDEEY---LELHMNLHE-----GKTE-K 251

  Fly   730 QCPLCPKNFKK--HSLRAHLRNHTNEKIFECTECLQKFARRHNLKNH----------VITKHAKV 782
            ||..|||:|.:  ::|| |:|.|.::|.::|.:|..:|::.:.|.||          :|.....|
  Fly   252 QCRYCPKSFSRPVNTLR-HMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNV 315

  Fly   783 GDKEKKKYAAKDV--EQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGR- 844
            ..|.:|.:....:  ::::|::.|..|.|...::|:||:|..:|.           .|..|..| 
  Fly   316 SFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHE-----------GDVVYGVRE 369

  Fly   845 ------------------TPESLKTHLVSHSQENHK-CARINCSYVGKSELHLKRHLKSAH 886
                              ..|:..|.::|.:.||.. |...|.::..|.|  |:.||:..|
  Fly   370 EAPADEQQVVEELHVDVDESEAAVTVIMSDNDENSGFCLICNTNFENKKE--LEHHLQFDH 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/19 (21%)
C2H2 Zn finger 731..750 CDD:275368 9/20 (45%)
C2H2 Zn finger 758..779 CDD:275368 7/30 (23%)
C2H2 Zn finger 804..824 CDD:275368 7/19 (37%)
C2H2 Zn finger 834..856 CDD:275368 5/40 (13%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 49/204 (24%)
C2H2 Zn finger 225..245 CDD:275368 7/62 (11%)
C2H2 Zn finger 253..273 CDD:275368 9/20 (45%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..327 CDD:275370 3/16 (19%)
zf-C2H2 337..359 CDD:278523 7/21 (33%)
C2H2 Zn finger 339..359 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.