DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and CG2678

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:474 Identity:97/474 - (20%)
Similarity:160/474 - (33%) Gaps:171/474 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 ITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDN----- 569
            :.:.|.::|:...|       ||.            :|..|....|.::.|..|.|...|     
  Fly    30 VLDEPEMSLSHILA-------RCT------------ERPVKRGDLLPQFICVSCVLAVQNAFRFK 75

  Fly   570 --SLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKT 632
              |..:.:|...|:::..|        |||:: |:             |..:.|.|...:...:.
  Fly    76 WQSEQSYQHFFRVLNQSGA--------PENQV-HL-------------AACNGDKNQIINQKMQL 118

  Fly   633 IESSQRLAQHQAEVHSSDNHLCLSCGISFESAQA---------------LGRHTRSCQPLASTST 682
            ....|:..|...:....|:.|...     ::.||               |....|:|:    |..
  Fly   119 KSDRQQDTQQMTKTQKPDDDLSQK-----QTLQAKLQEGNIDGPPESFTLHPRKRTCR----TEE 174

  Fly   683 PADL--SQAQKKS--------MYSCDQC--RFQSQYE-----SDLVYHRIFHTRSGTIGKNEVLQ 730
            .||:  .:|.:.:        .|:|..|  ||.||.:     :||..                 :
  Fly   175 QADMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQLRTHITDLCN-----------------R 222

  Fly   731 CPLCPKNF-KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNH-----------------VIT 777
            ||.||:.: :|.:|:.|||||.::...:|..|.:.|.|:.:||.|                 |..
  Fly   223 CPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFI 287

  Fly   778 KHAKV-----------GDKEKKKYAAKDVEQS-------------------------KPKYQCGT 806
            :|.::           |..:.:.....|.:.|                         |||..|..
  Fly   288 EHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDI 352

  Fly   807 CGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAG---RTPESLKTHLVSHSQENHKCARINC 868
            |.|..:..|:||.|.::|      |...|...|:|..   :|.:.||.|...|..:..:|.  .|
  Fly   353 CQKKFSSVYALKRHMLTH------NRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDLFRCE--FC 409

  Fly   869 SYVGKSELHLKRHLKSAHS 887
            |.|.....:|::|.|..||
  Fly   410 SLVFVDVNYLRKHKKRIHS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 8/26 (31%)
C2H2 Zn finger 731..750 CDD:275368 9/19 (47%)
C2H2 Zn finger 758..779 CDD:275368 8/37 (22%)
C2H2 Zn finger 804..824 CDD:275368 7/19 (37%)
C2H2 Zn finger 834..856 CDD:275368 7/24 (29%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 13/73 (18%)
COG5048 220..>284 CDD:227381 18/80 (23%)
C2H2 Zn finger 223..243 CDD:275368 9/19 (47%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.