DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and CG1024

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:547 Identity:117/547 - (21%)
Similarity:193/547 - (35%) Gaps:145/547 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 LNRSVPICIAQRR---RIQ------CSRCGMEFLYNIQLRQHSITEHPGLALTGTAAD--EYQSR 529
            ::|:|.:...|.|   |::      |..||..|....:.|||..|:|..|..|.:..:  :...|
  Fly     5 MSRNVTLSDEQSRLNARLEAHMVYICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDER 69

  Fly   530 F-RCNLC----GSSQKSRLALQRHK-KHKHHLARYFCAICRLEFDNSLDARRHRSLVIHKQKARP 588
            | .|.||    .::.|:...||.|. .|..|...|.|..||:.:      .|.|:|.:|..... 
  Fly    70 FHECQLCFKWVENAHKTIALLQYHYFMHLEHSETYRCVHCRMAY------TRRRALNVHLLDTH- 127

  Fly   589 QTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNA-------KCSNSRKTIESSQRLAQHQAEV 646
            ...|.:.||::..|.|:..:.|..:.||..:....|       |.|.:||..:..|:...     
  Fly   128 MREIEKYENKLRQMKRQQAKPTTAAAPAGNAEKPMAVKPRGRPKGSTNRKQNDLLQKALM----- 187

  Fly   647 HSSDNHLCLSCGISFESAQALGRHTRSCQPLASTS---------TPADLSQAQKKSMYSCDQCRF 702
                 .:.|:..:......||.......:|:::.|         ...|:.:.::|.:.       
  Fly   188 -----DIDLNTEMEKSPVTALAAPVNEPKPISNVSELNLDRCLNAYEDIVRKEEKEVV------- 240

  Fly   703 QSQYESDL-VYHRIFHTRSGTIGKNEVLQCPLCPKNFKKHSLRAHLRNHTNEKIFECTECLQK-- 764
             .:|:.:| ...:.|.....:.||.|.        |.::....|||:....|.:....:.|.|  
  Fly   241 -PKYDDELDALCKEFFDDGPSAGKGEA--------NEEQQQDDAHLQQGNQEVVIIEIDALGKEE 296

  Fly   765 -FARRHNLKNHVI---TKHAKVGDKEKKKYAAKDVEQSKP------KYQCGTCGKLLA-----KK 814
             ...:..:|:..|   ||..::.....:.   .|.|.|..      .|.|..|||.:|     :.
  Fly   297 VAQLKKEMKSDPISQPTKRRRISTTPSRD---SDTEMSTNGLTKLISYLCPKCGKEIASMDGWRA 358

  Fly   815 YSLKLHEISH-----SKAVE--RNYLC--------------------------HFADCSYAGRTP 846
            :..|.|:..|     .|.:|  |..:|                          .:..|:...||.
  Fly   359 HVFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKHCFKHLPYRSYLKCTLCDRTK 423

  Fly   847 ESLKTHLVSHSQENH--KCARINCSYVGKSELHLKRHLKSAHSTEKNGE--------------EW 895
            .| .:.:::|.:.||  :..|.|     |::|.:|.....| |..|:|:              |.
  Fly   424 TS-TSKILNHIRYNHQEELQRKN-----KTQLLIKPEPMWA-SPNKSGQAAMADDAGSEDDQGEQ 481

  Fly   896 FSCDQCDFRARIKGHLRRH--SLRHSG 920
            ..|:.||...|.|....||  |.|.||
  Fly   482 AVCEHCDRVFRSKWRYERHIASCRRSG 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 2/20 (10%)
C2H2 Zn finger 731..750 CDD:275368 4/18 (22%)
C2H2 Zn finger 758..779 CDD:275368 5/26 (19%)
C2H2 Zn finger 804..824 CDD:275368 7/24 (29%)
C2H2 Zn finger 834..856 CDD:275368 5/47 (11%)
C2H2 Zn finger 898..918 CDD:275368 8/21 (38%)
zf-H2C2_2 910..935 CDD:290200 6/13 (46%)
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 8/20 (40%)
C2H2 Zn finger 73..100 CDD:275368 8/26 (31%)
C2H2 Zn finger 106..123 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.