DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and Neu2

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:434 Identity:100/434 - (23%)
Similarity:159/434 - (36%) Gaps:123/434 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 KHH-LARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPP 615
            ||. |:...|..|..:..|:.|       :|...         :..::....|::|.||      
  Fly    29 KHDPLSNTICKSCLEDAQNAFD-------IIETY---------ERSHQFYRFLKDVREE------ 71

  Fly   616 AKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLS-CGISFESAQALGRHTRSCQPLAS 679
              .|.:..:.||   :.:|:::|..|..|:...|.|...:: |.|                    
  Fly    72 --ESENDGSGCS---EEVEAAERDLQDGADDVDSGNEPDINECDI-------------------- 111

  Fly   680 TSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNFKKHS-L 743
                    :|::|..:||..|....|.:|:|..|...||     |:.. ..|.||||:|...| |
  Fly   112 --------KAKEKPGFSCSHCPKSFQVKSNLKVHMRSHT-----GERP-FTCSLCPKSFGYSSGL 162

  Fly   744 RAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCG 808
            :.|:|.||.|:.|:|:.|.:.|...|:||.|:                  .:.:.:...:|..|.
  Fly   163 QNHMRTHTGERPFQCSHCPRSFTAGHHLKAHI------------------QMHERRGSLRCPYCQ 209

  Fly   809 KLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCSYVGK 873
            |.......||.|..:|:.  |..:.|  :.||.:.:....|..|:..|.:....|.  :||....
  Fly   210 KCFLTSLILKQHLATHTD--ETQFKC--SQCSKSFQVEHELWMHMRVHQERLFTCG--HCSKDFA 268

  Fly   874 SELHLKRHLK-----------SAHSTEKNGEEWFSCDQC----DFRARIKGHLRRHSLR------ 917
            ...:|||||.           |||.|..:.:. ..|.:|    ..|:.:..||:.|:..      
  Fly   269 LHAYLKRHLSRNARCSQSSKASAHKTLGHSKA-LKCGKCPKTFTDRSALSTHLKSHTKNKPLLEG 332

  Fly   918 ----------HSG--QKPHQCPHCDFQCSTIDNLRKHI-IKTGK 948
                      ||.  :||.:|..|....|....|..|: ..|||
  Fly   333 PCKSSGSKPAHSNAQRKPFKCSSCPRTFSRKSALLTHLQTHTGK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/19 (32%)
C2H2 Zn finger 731..750 CDD:275368 10/19 (53%)
C2H2 Zn finger 758..779 CDD:275368 7/20 (35%)
C2H2 Zn finger 804..824 CDD:275368 6/19 (32%)
C2H2 Zn finger 834..856 CDD:275368 5/21 (24%)
C2H2 Zn finger 898..918 CDD:275368 6/39 (15%)
zf-H2C2_2 910..935 CDD:290200 9/42 (21%)
C2H2 Zn finger 926..945 CDD:275368 5/19 (26%)
C2H2 Zn finger 957..984 CDD:275368
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 8/49 (16%)
COG5048 <119..241 CDD:227381 42/149 (28%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-H2C2_2 133..158 CDD:290200 11/30 (37%)
C2H2 Zn finger 149..169 CDD:275368 10/19 (53%)
zf-H2C2_2 162..185 CDD:290200 9/22 (41%)
C2H2 Zn finger 177..197 CDD:275368 7/37 (19%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-C2H2_8 206..286 CDD:292531 21/85 (25%)
C2H2 Zn finger 233..253 CDD:275368 5/21 (24%)
C2H2 Zn finger 260..297 CDD:275368 12/38 (32%)
C2H2 Zn finger 303..323 CDD:275368 5/19 (26%)
C2H2 Zn finger 353..373 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.