DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and CG10654

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:399 Identity:83/399 - (20%)
Similarity:141/399 - (35%) Gaps:124/399 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 DVNAKCSNSRKTIESSQRLAQ------HQAEVHS-----------------SDNHL-CLSCG--- 658
            |....|:.|.:..|   :|.|      |:.|.|:                 :.:|. |::..   
  Fly   100 DFQRMCAESLRNFE---KLLQDIDIGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIAATQEI 161

  Fly   659 ISFESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSC-DQCRFQSQYESDL-VYHRIFHTRSG 721
            :||...|.       |.|||...:...|..:.::.:|.. |:...|...:..| :..::...|..
  Fly   162 VSFIWPQV-------CLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKR 219

  Fly   722 TIGKNEVLQCPLCPKNFKKHS-LRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDK 785
            . |....|:|.:|.:.|.|.| |.||::.|...:.:.|..|.:.:||.:.|::|:...|      
  Fly   220 R-GVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMH------ 277

  Fly   786 EKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLK 850
                   .:.:.::..|.|.:|.|:.....|||.|                           ..:
  Fly   278 -------NNADAARIIYACPSCNKVYTANRSLKYH---------------------------MRR 308

  Fly   851 THLVSHSQENHKCARINCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHS 915
            ||...|..|:...                ||:               |::|......|.||.||.
  Fly   309 THERYHESESPDA----------------RHI---------------CEECGKCFARKAHLTRHK 342

  Fly   916 LRHSGQKPHQ--CPHCDFQCSTIDNLRKHIIKTGKHPGM-FIYHCAKCSDEEAGEIFKSNSYKEY 977
            :.|...:..:  |..||.:..|.:|:..|:::  ||... .:..|.||     |.||:::  .|.
  Fly   343 MVHGSVEGRRYCCECCDRRFYTKENMVDHLLR--KHGNKNLLLRCRKC-----GRIFQNS--VEL 398

  Fly   978 QHHLKTHKA 986
            ..|.:.|||
  Fly   399 NAHGRKHKA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 3/21 (14%)
C2H2 Zn finger 731..750 CDD:275368 8/19 (42%)
C2H2 Zn finger 758..779 CDD:275368 6/20 (30%)
C2H2 Zn finger 804..824 CDD:275368 7/19 (37%)
C2H2 Zn finger 834..856 CDD:275368 2/21 (10%)
C2H2 Zn finger 898..918 CDD:275368 7/19 (37%)
zf-H2C2_2 910..935 CDD:290200 8/26 (31%)
C2H2 Zn finger 926..945 CDD:275368 6/18 (33%)
C2H2 Zn finger 957..984 CDD:275368 8/26 (31%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 4/17 (24%)
C2H2 Zn finger 228..248 CDD:275368 8/19 (42%)
C2H2 Zn finger 256..313 CDD:275368 17/96 (18%)
C2H2 Zn finger 289..314 CDD:275368 9/51 (18%)
zf-C2H2 323..345 CDD:278523 8/36 (22%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 6/22 (27%)
C2H2 Zn finger 385..405 CDD:275368 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.