DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and az2

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:737 Identity:141/737 - (19%)
Similarity:236/737 - (32%) Gaps:255/737 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SLQLQSVATGGKIGSVPRQERSKDESWSAPAGDPLLKAVREN--DETVFKPLHFDHEYPEASDEE 181
            |:| |.:.|...|.|      :|.|...:||...:::...||  .|.:|.      :.|.:|:.:
  Fly    51 SMQ-QELTTSEVISS------AKCEEEVSPAKVFIVEEPPENCLAEDMFV------DVPPSSEND 102

  Fly   182 DDEDEHEEFDAEEDEEEYDA--------RRHSPPIVPASHTGGKWKP---EQRPQLRHPHIERLS 235
            :.....||.:.|:||.:..:        .|:|....|.:    |:.|   .:.|::.. .||...
  Fly   103 ESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLT----KFNPTFYRRSPRITQ-FIELYK 162

  Fly   236 PS---WDEPPEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLDQPGASYWCNICCRRLKSRLY 297
            ..   || |.:|:|                :..|.|.|.....|:|             ||:.: 
  Fly   163 QQTCLWD-PADESY----------------RDKEKRANAYEELLEQ-------------LKATV- 196

  Fly   298 YNQHLRSGYHIKRAEAECELEQATLGRELTLSKDFSIKDDADKNEPKPPKRQRRANLLRCDLCRH 362
             |.|| :.|.:|:.......:.|::.|:                       ::...|.:..|..|
  Fly   197 -NLHL-TAYKLKKCITSLHAQYASISRQ-----------------------KKTQKLTKVPLYYH 236

  Fly   363 TMARHLIGKHLISHYHFRRLQQQSRIRRQACLQEI----------LKHMGSIVRQSPFQCMPCRF 417
                   ||:             |.:..:..|::.          :|.:.:...|...|.:.  .
  Fly   237 -------GKY-------------SFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFID--L 279

  Fly   418 YANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLAL--NRSV 480
            |:...:  ||. .:|:|              ||  |.|...|.|:.:.|....|..|.|  :..|
  Fly   280 YSKFPQ--LYD-PAHKH--------------FC--NLNVRKSSLIEITDLLTSEFSLGLVTHYDV 325

  Fly   481 PICIAQRRRIQCSRCGMEFLYNIQLRQHSITEHPGLALTGT--AADEYQSRFRCNLCGSSQKSRL 543
            ...|...|:....|  ::.|.::|....|:.|...:....:  ....::.:.:|.:|..|..:..
  Fly   326 YDSIQSMRQWYSRR--IKTLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDH 388

  Fly   544 ALQRHKKHKHHLAR---YFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLRE 605
            |||.|:...|.:..   :.|.:|.|.||.                                    
  Fly   389 ALQAHQFRDHKMGDGGWFRCTLCELNFDR------------------------------------ 417

  Fly   606 VLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLSCGISFESAQALGRH 670
                               ||           .|.||...||...:.:|..|..||.....|..|
  Fly   418 -------------------KC-----------HLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIH 452

  Fly   671 TRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYH-RIFHTRSGTIGKNEVLQCPLC 734
            .|:          .|.....|.  :.|:.|....:.:..:..| ...||      |....:|.:|
  Fly   453 KRT----------HDEKHVAKP--FVCEFCGKCFKQKIQMTTHVTAVHT------KIRAFKCDMC 499

  Fly   735 PKNF-KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQS 798
            ||:| .|..|:.|::.|.|.:...|..|.:.|...:.|..|   :|.   .|||           
  Fly   500 PKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKH---RHI---HKEK----------- 547

  Fly   799 KPKYQCGTCGKLLAKKYSLKLH 820
              ..||..|....:::.||.:|
  Fly   548 --TLQCSLCTTRFSERVSLGVH 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 3/20 (15%)
C2H2 Zn finger 731..750 CDD:275368 8/19 (42%)
C2H2 Zn finger 758..779 CDD:275368 5/20 (25%)
C2H2 Zn finger 804..824 CDD:275368 5/17 (29%)
C2H2 Zn finger 834..856 CDD:275368
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 27/160 (17%)
GT1 276..>341 CDD:304916 19/87 (22%)
C2H2 Zn finger 377..398 CDD:275368 7/20 (35%)
C2H2 Zn finger 408..429 CDD:275368 10/86 (12%)
C2H2 Zn finger 436..456 CDD:275368 7/29 (24%)
C2H2 Zn finger 467..488 CDD:275368 3/20 (15%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 6/25 (24%)
C2H2 Zn finger 551..572 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.