DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and zf30C

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster


Alignment Length:676 Identity:140/676 - (20%)
Similarity:223/676 - (32%) Gaps:237/676 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 QCSRCGMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHK--- 552
            :|..|...|.:..:|.||:..||   .:||..|.:.:..|.|..||:..|.:.|.:||.:.|   
  Fly    60 ECRHCDARFCHEEELTQHAKDEH---GVTGAVAGQERKPFVCEKCGAEYKYQEAYRRHCRTKCGE 121

  Fly   553 HHLAR-----YFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPE---------------- 596
            ..|.|     ..|..|...|.::.:..:||       ::||.| ..|||                
  Fly   122 EKLPREESRPMECKCCYTRFSSASNLSKHR-------RSRPDT-CGQPEYDSPGSSDGMKKHKAF 178

  Fly   597 --------NEIEHMLREVLEETVPSPP-----------AKRSADVNAKC-----SNSRKTI---- 633
                    ::.|....|..|::....|           ..:::|...:|     :||....    
  Fly   179 RKKDRNRDSDDEDTTSEESEDSDDDIPLASRLKTKLKQESQNSDSGDECPDFEPNNSEDDADASG 243

  Fly   634 ----------------------ESSQRLAQHQAEVHSSDNHLCLSCGIS-------FESAQA--- 666
                                  ::|..:.....::.|::....|...::       |||.:.   
  Fly   244 FQLPPPAMVKVEAFDEEDFEYQDASMYVKTESTDIFSNEKDKLLDVLLNEGDGLKPFESLKVEQG 308

  Fly   667 ----------------------LGRH-------------------------------TRSCQPLA 678
                                  |..|                               .||..|..
  Fly   309 AGILDEIAAVPLVEVAEEDVLELRGHQMEKPPGPRKRGRPPKEKIPVVKRKYRKRNAPRSPSPDD 373

  Fly   679 STSTPADLSQAQKKSM-------------YSCDQC----RFQSQYESDL-VYHRIFHTRSGTIGK 725
            |:.||..:::..||.:             :.|..|    ..:..||..| ..|::.......|.|
  Fly   374 SSGTPKRVAKISKKELKERLKMINKMEKSWKCPHCVKIYHIRKPYEKHLRDDHKLNEAEMKEIFK 438

  Fly   726 N---------EVLQCPLCPKNF-KKHSLRAHLRNHTNE-KI-FEC-TECLQKFARRHNLKNHVIT 777
            :         ||.:||:|.|.: .:..|..|::.|..: |: |:| ..|...||.:..     .|
  Fly   439 DVDVHAKLDEEVFKCPICSKIYLVEKRLVTHMKVHGEDGKLTFKCPCYCNLFFATKEQ-----AT 498

  Fly   778 KHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEIS-HSK----AVERNYLCHFA 837
            :||:.              |.|....|..|.|.:....|||.||.: |||    :.:||.:|...
  Fly   499 EHARA--------------QHKELLYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICDKC 549

  Fly   838 DCSYAGRTPESLKTHLVSHSQENHKCARI---NCSYVGKSELHLKRHLKSA-----HSTEKNGEE 894
            ...:.|||  ||..|:.|      .|.|:   .||..||       ||.:|     |......:.
  Fly   550 GKKFTGRT--SLSDHVRS------DCGRLPLYGCSVCGK-------HLSTAGILKTHMLLHKADT 599

  Fly   895 WFSCDQCDFRARIKGHLRRH-SLRHSGQKPHQCPHCDFQCSTIDNLRKHIIKTGKHPGMFIYHCA 958
            .:.||:|....::|...:.| ..||:..||::|..|..:....::|..|:.   .|.|:..:.|.
  Fly   600 PYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMT---VHTGIKRFLCN 661

  Fly   959 KCSDEEAGEIFKSNSYKEYQHHLKTH 984
            .|     |:.|...|  ..|.|.|.|
  Fly   662 NC-----GKRFTCIS--NLQAHRKVH 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/24 (25%)
C2H2 Zn finger 731..750 CDD:275368 6/19 (32%)
C2H2 Zn finger 758..779 CDD:275368 5/21 (24%)
C2H2 Zn finger 804..824 CDD:275368 8/20 (40%)
C2H2 Zn finger 834..856 CDD:275368 7/21 (33%)
C2H2 Zn finger 898..918 CDD:275368 5/20 (25%)
zf-H2C2_2 910..935 CDD:290200 7/25 (28%)
C2H2 Zn finger 926..945 CDD:275368 4/18 (22%)
C2H2 Zn finger 957..984 CDD:275368 8/26 (31%)
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368 6/20 (30%)
C2H2 Zn finger 98..117 CDD:275368 7/18 (39%)
C2H2 Zn finger 134..152 CDD:275368 5/24 (21%)
C2H2 Zn finger 511..532 CDD:275370 8/20 (40%)
COG5048 <523..>672 CDD:227381 48/173 (28%)
C2H2 Zn finger 546..566 CDD:275368 8/27 (30%)
C2H2 Zn finger 575..595 CDD:275368 8/26 (31%)
C2H2 Zn finger 603..624 CDD:275368 5/20 (25%)
C2H2 Zn finger 632..652 CDD:275368 4/22 (18%)
C2H2 Zn finger 660..680 CDD:275368 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.