DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and CG9609

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:428 Identity:96/428 - (22%)
Similarity:154/428 - (35%) Gaps:133/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 PQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAK--CS--NSRKTIESSQRLAQHQAEVHS 648
            |.|.|.. ::::|..|.|..:.     ..:|::..:||  ||  ....|.:...:|.:|:.....
  Fly     3 PGTQIAS-DSDMETALEEFKQR-----QGRRNSIGSAKYACSMPKCEATFKRLDQLDRHEYHHTG 61

  Fly   649 SDNHLCL--SCGISFESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLV 711
            ...|.|.  .|..::.....|.||.||.                                     
  Fly    62 IKKHACSYEGCDKTYSIVTHLKRHLRST------------------------------------- 89

  Fly   712 YHRIFHTRSGTIGKNEVLQCPL--CPKNF-KKHSLRAHLR-NHTNEKIFECTECLQKFARRHNLK 772
                 |.|..:..|..| :|.|  |.|.| ...::..|:| .|.:.|::.|::|..||:::..||
  Fly    90 -----HERPESAAKKTV-KCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLK 148

  Fly   773 NHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFA 837
            .|.|.:|.       .:|          .|.|..|.:...:::..:.||.|          |...
  Fly   149 RHEIREHT-------LEY----------PYSCSKCSRGFYQQWQCQSHEPS----------CKLY 186

  Fly   838 DCS-----------YAGRTPESLKTHLVSHSQENHKCARINCSYVGKSELHLKRHLKSAHSTEKN 891
            :|.           |.....:||      |.:..|||.|.:.::...||  |||||:..|.....
  Fly   187 ECPGCPLQFDKWTLYTKHCRDSL------HGKNRHKCDRCDSAFDKPSE--LKRHLEVKHKEAAQ 243

  Fly   892 GEEW---FSCDQ--CDFRARIKGHLRRHSL-RHSGQKPHQCPHCDFQCSTID---------NLRK 941
            .:|.   |:|::  |........:||:|.| .|||::        |:|..:|         ||.:
  Fly   244 TDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRR--------FECQALDCGRCFSSAQNLAR 300

  Fly   942 HIIKTGKHPGMFIYHCAKCSDE----EAGEIFKSNSYK 975
            |:::..|.........||..|:    |.|:. ||.|.|
  Fly   301 HLLRDHKDGATKKELKAKKKDKSKTGEGGKT-KSTSRK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 0/19 (0%)
C2H2 Zn finger 731..750 CDD:275368 7/22 (32%)
C2H2 Zn finger 758..779 CDD:275368 8/20 (40%)
C2H2 Zn finger 804..824 CDD:275368 4/19 (21%)
C2H2 Zn finger 834..856 CDD:275368 5/32 (16%)
C2H2 Zn finger 898..918 CDD:275368 6/22 (27%)
zf-H2C2_2 910..935 CDD:290200 9/25 (36%)
C2H2 Zn finger 926..945 CDD:275368 6/27 (22%)
C2H2 Zn finger 957..984 CDD:275368 9/23 (39%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 3/18 (17%)
zf-C2H2_8 67..150 CDD:292531 26/125 (21%)
C2H2 Zn finger 67..90 CDD:275368 7/64 (11%)
C2H2 Zn finger 106..126 CDD:275368 5/19 (26%)
C2H2 Zn finger 134..155 CDD:275368 8/20 (40%)
C2H2 Zn finger 188..210 CDD:275368 4/27 (15%)
C2H2 Zn finger 217..237 CDD:275368 9/21 (43%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.