DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and CG2120

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:110/289 - (38%) Gaps:87/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 RSGTIGKNEVLQCPLCPKNFKK-HSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKV 782
            |..|.||:..  |.:|.:.|.: ::||.|...||:||...|.||.:.|.:.:.|:.|.:|..|: 
  Fly    91 RHRTTGKDHT--CDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAE- 152

  Fly   783 GDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPE 847
                            :| ::|..|||.......|.:|...|:.  |:.|.|...||..:..:..
  Fly   153 ----------------RP-HKCDICGKGFRYANYLTVHRRLHTG--EKPYPCLATDCHLSFHSIH 198

  Fly   848 SLKTHL-VSHS-------------QENHKCARIN-----CSYVGKSELHLKRHLKSAHSTEKNGE 893
            :.:.|. :.|:             ||....:.::     ||.|...:.:|..||| .|..:::  
  Fly   199 ARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLK-RHYNQRD-- 260

  Fly   894 EWFSCDQ--CDFRARIKGHLRRHSLRHSGQKPHQCPHCDFQCSTIDNLRKHIIKTGKHPGMFIYH 956
              |.|.|  |..|......|:.|.:.|:.|:|..||.|                    |..|:. 
  Fly   261 --FPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLC--------------------PARFLR- 302

  Fly   957 CAKCSDEEAGEIFKSNSYKEYQHHLKTHK 985
                         |||    ::.|||.|:
  Fly   303 -------------KSN----HKQHLKVHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368
C2H2 Zn finger 731..750 CDD:275368 6/19 (32%)
C2H2 Zn finger 758..779 CDD:275368 7/20 (35%)
C2H2 Zn finger 804..824 CDD:275368 6/19 (32%)
C2H2 Zn finger 834..856 CDD:275368 4/22 (18%)
C2H2 Zn finger 898..918 CDD:275368 6/21 (29%)
zf-H2C2_2 910..935 CDD:290200 8/24 (33%)
C2H2 Zn finger 926..945 CDD:275368 3/18 (17%)
C2H2 Zn finger 957..984 CDD:275368 6/26 (23%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 11/24 (46%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 9/41 (22%)
COG5048 151..>264 CDD:227381 27/137 (20%)
C2H2 Zn finger 157..177 CDD:275368 6/19 (32%)
C2H2 Zn finger 185..206 CDD:275368 4/20 (20%)
C2H2 Zn finger 235..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 263..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 11/57 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.