DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and let-391

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_491744.3 Gene:let-391 / 182953 WormBaseID:WBGene00006492 Length:453 Species:Caenorhabditis elegans


Alignment Length:457 Identity:92/457 - (20%)
Similarity:160/457 - (35%) Gaps:118/457 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 WCSFCQFNSNTNNSMLLHLL---DSSHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYNIQLRQ 507
            |.:.|..::...:..|..::   ||::::  ...|:.:|....      |..||:...|..::.:
 Worm    18 WAAECTPDAQKEHEELEEIVKIPDSTYRK--KKGNQKLPTVTT------CEVCGVALKYPSRIME 74

  Fly   508 HSITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHKH-----HLARYFCAICRLEF 567
            |..| |.|           :..:.|::||.....|..:..|.:.:|     .|..:.|.   ..|
 Worm    75 HMRT-HTG-----------EKPYECDICGMRFTQRTPMINHFRVQHMGDLPFLCNFGCG---KRF 124

  Fly   568 DNSLDARRHRSLVIH---------KQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVN 623
            .|  ::||....:.|         :...:|...|..|..:::.:....|...: |||        
 Worm   125 VN--NSRRTAHELSHNGLKRAGPARPYLKPVKKIVCPSMDMDILSNSALANYI-SPP-------- 178

  Fly   624 AKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLSCGISFESAQALGRHTRSCQPLASTSTPADLSQ 688
                    ||:|          :..||.....|....|:|:....:  :|..|.......|.:|.
 Worm   179 --------TIDS----------IFQSDPSTSSSSPSQFQSSNQTTK--QSIYPSEKEMEKAAISN 223

  Fly   689 AQKKSMYSCDQCRFQSQYESDLVYHR---------IFHTRSGTIGKNEVLQCPLCPKNFKKHS-L 743
            |:...:.:....|..:..:.::....         ....|..|:.     ||.:|....|..| :
 Worm   224 ARIDDVINTVLARVLAPIDEEIPIEEPEKAPQKRAYISNRRATLA-----QCNICGLMLKHPSKI 283

  Fly   744 RAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQC-GTC 807
            ..|:|.||.||.|||.||....::..:||.|:...|  .|::               .::| ..|
 Worm   284 ADHIRTHTGEKPFECGECGLSLSKASSLKVHIRRMH--TGER---------------PFECTWRC 331

  Fly   808 GKLLAKKYSLKLHEISHSKAVERNYLCHFADCS--YAGRT----------PESLKTHLVSHSQEN 860
            |.........|.||::....::| |.|....|:  :|.|.          || |.|.:..|.|.|
 Worm   332 GLSFVTDSVRKEHEMTVHTGIKR-YTCVVKGCNAVFARRVYLMRHRKNAHPE-LFTPIFDHVQVN 394

  Fly   861 HK 862
            |:
 Worm   395 HE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 1/28 (4%)
C2H2 Zn finger 731..750 CDD:275368 6/19 (32%)
C2H2 Zn finger 758..779 CDD:275368 6/20 (30%)
C2H2 Zn finger 804..824 CDD:275368 6/20 (30%)
C2H2 Zn finger 834..856 CDD:275368 8/33 (24%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
let-391NP_491744.3 C2H2 Zn finger 59..79 CDD:275368 6/20 (30%)
zf-H2C2_2 73..96 CDD:290200 7/34 (21%)
C2H2 Zn finger 87..108 CDD:275368 5/20 (25%)
C2H2 Zn finger 116..137 CDD:275368 5/25 (20%)
C2H2 Zn finger 270..290 CDD:275368 6/19 (32%)
zf-H2C2_2 286..304 CDD:290200 11/17 (65%)
C2H2 Zn finger 298..319 CDD:275368 6/20 (30%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.