DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31612 and ZFP28

DIOPT Version :9

Sequence 1:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_065879.1 Gene:ZFP28 / 140612 HGNCID:17801 Length:868 Species:Homo sapiens


Alignment Length:979 Identity:209/979 - (21%)
Similarity:314/979 - (32%) Gaps:296/979 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RKRNCLIT-GKQNASPKTDG-RTRISADT--------------------HVSATLISSSN--LDH 69
            |.||.|.: |::.|:|...| |...|.||                    .:|..|::..:  :|.
Human    48 RSRNGLASKGQRGAAPTGPGHRALPSRDTALPQERNKKLEAVGTGIEPKAMSQGLVTFGDVAVDF 112

  Fly    70 SYDGFHFTEPEAPSSYLRKTAASHGGKTSKSLTEAYDLPYELGADLFFSSLQLQSVATGGKIGSV 134
            |.:.:.:..|...:.|            .|.:.|.|.....||  |..|...:.|....||    
Human   113 SQEEWEWLNPIQRNLY------------RKVMLENYRNLASLG--LCVSKPDVISSLEQGK---- 159

  Fly   135 PRQERSKDESWSAP-----AGDPLLKAVRENDETVFKPLHFDHEYPEASDEEDDEDEHEEFDAEE 194
                    |.|:..     |..|.||||.:..|...|....:.:..:|...|.....:.|:....
Human   160 --------EPWTVKRKMTRAWCPDLKAVWKIKELPLKKDFCEGKLSQAVITERLTSYNLEYSLLG 216

  Fly   195 DEEEYDARRHSPP-IVPASHTGGKWKPEQRPQLRHPHIERLSPS--WDEPPEENYTHPPADHTKG 256
            :..:|||...:.| :|...:..    .:.|.|| ||..:....:  |    |.|.....|.|...
Human   217 EHWDYDALFETQPGLVTIKNLA----VDFRQQL-HPAQKNFCKNGIW----ENNSDLGSAGHCVA 272

  Fly   257 K-------------W-----VPGS----------------KQLEYRENL----DLTKLDQPGASY 283
            |             |     :.||                ||..|.|.:    ..||||      
Human   273 KPDLVSLLEQEKEPWMVKRELTGSLFSGQRSVHETQELFPKQDSYAEGVTDRTSNTKLD------ 331

  Fly   284 WCNICCRRLKSRLYYNQHLRSGYHIKRAEAECELEQATLGRELTLSKD-----------FSIKDD 337
             |:.......|...:.:.|..|       .|.:..|..:....||||:           |.:   
Human   332 -CSSFRENWDSDYVFGRKLAVG-------QETQFRQEPITHNKTLSKERERTYNKSGRWFYL--- 385

  Fly   338 ADKNEPKPPKRQRRANLLRCDLCRHTMARHLIGKHLISHYHFRRLQQQSRIRRQACLQEILKHMG 402
             |.:|.|...|....|.                             |:|.:        ::|..|
Human   386 -DDSEEKVHNRDSIKNF-----------------------------QKSSV--------VIKQTG 412

  Fly   403 SIVRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDS 467
            ....:..|:|..|:.......:...|.:.|...:..|       |:.|....:..:|...|    
Human   413 IYAGKKLFKCNECKKTFTQSSSLTVHQRIHTGEKPYK-------CNECGKAFSDGSSFARH---- 466

  Fly   468 SHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFRC 532
                         ..|...::..:|..||..|:.|..|.:|....|.|           :..|.|
Human   467 -------------QRCHTGKKPYECIECGKAFIQNTSLIRHWRYYHTG-----------EKPFDC 507

  Fly   533 NLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPEN 597
            ..||.:....:.|.:|::.......|.|.:|...|      |...||.:|::       |...|.
Human   508 IDCGKAFSDHIGLNQHRRIHTGEKPYKCDVCHKSF------RYGSSLTVHQR-------IHTGEK 559

  Fly   598 EIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHL-CLSCGISF 661
            ..|                         |...||.......|.||| .|||.:... |..||.:|
Human   560 PYE-------------------------CDVCRKAFSHHASLTQHQ-RVHSGEKPFKCKECGKAF 598

  Fly   662 ESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKN 726
            .....|..|.|             :...:|.  :.|.:|.......|.|..|:..||      ..
Human   599 RQNIHLASHLR-------------IHTGEKP--FECAECGKSFSISSQLATHQRIHT------GE 642

  Fly   727 EVLQCPLCPKNF-KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKY 790
            :..:|.:|.|.| :|..|..|.:.||.||.:||.||.:.|::    ..|:| :|.:|...||   
Human   643 KPYECKVCSKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQ----TTHLI-QHQRVHTGEK--- 699

  Fly   791 AAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVS 855
                      .|:|..|||......|...|:..|:.  :|.|.|  .:|..|.:|..||..|..|
Human   700 ----------PYKCMECGKAFGDNSSCTQHQRLHTG--QRPYEC--IECGKAFKTKSSLICHRRS 750

  Fly   856 HSQENHKCARINCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSG 920
            |:.|.    ...||..||:..|  |...|.|....:|::.:.|.:|.......|||.:|...|:|
Human   751 HTGEK----PYECSVCGKAFSH--RQSLSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVHTG 809

  Fly   921 QKPH 924
            ::.:
Human   810 ERSY 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 5/19 (26%)
C2H2 Zn finger 731..750 CDD:275368 7/19 (37%)
C2H2 Zn finger 758..779 CDD:275368 6/20 (30%)
C2H2 Zn finger 804..824 CDD:275368 6/19 (32%)
C2H2 Zn finger 834..856 CDD:275368 7/21 (33%)
C2H2 Zn finger 898..918 CDD:275368 6/19 (32%)
zf-H2C2_2 910..935 CDD:290200 5/15 (33%)
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
ZFP28NP_065879.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 12/33 (36%)
KRAB 103..163 CDD:214630 15/85 (18%)
KRAB 103..142 CDD:279668 7/50 (14%)
KRAB 232..288 CDD:214630 12/64 (19%)
KRAB 232..266 CDD:279668 9/42 (21%)
COG5048 417..806 CDD:227381 119/511 (23%)
zf-C2H2 420..442 CDD:278523 4/21 (19%)
C2H2 Zn finger 422..442 CDD:275368 3/19 (16%)
zf-H2C2_2 434..458 CDD:290200 5/30 (17%)
C2H2 Zn finger 450..470 CDD:275368 4/36 (11%)
zf-H2C2_2 462..487 CDD:290200 7/41 (17%)
C2H2 Zn finger 478..496 CDD:275368 7/17 (41%)
C2H2 Zn finger 507..527 CDD:275368 5/19 (26%)
zf-H2C2_2 520..544 CDD:290200 6/29 (21%)
C2H2 Zn finger 535..555 CDD:275368 7/32 (22%)
zf-H2C2_2 547..572 CDD:290200 9/56 (16%)
C2H2 Zn finger 563..583 CDD:275368 7/20 (35%)
zf-H2C2_2 575..600 CDD:290200 11/25 (44%)
C2H2 Zn finger 591..611 CDD:275368 7/32 (22%)
zf-H2C2_2 603..627 CDD:290200 6/38 (16%)
C2H2 Zn finger 619..639 CDD:275368 5/19 (26%)
zf-H2C2_2 632..656 CDD:290200 8/29 (28%)
C2H2 Zn finger 647..667 CDD:275368 7/19 (37%)
zf-H2C2_2 659..684 CDD:290200 11/24 (46%)
C2H2 Zn finger 675..695 CDD:275368 7/24 (29%)
zf-H2C2_2 687..710 CDD:290200 11/36 (31%)
C2H2 Zn finger 703..723 CDD:275368 6/19 (32%)
zf-H2C2_2 718..740 CDD:290200 7/25 (28%)
C2H2 Zn finger 731..751 CDD:275368 7/21 (33%)
zf-H2C2_2 743..768 CDD:290200 10/28 (36%)
C2H2 Zn finger 759..779 CDD:275368 8/21 (38%)
zf-H2C2_2 771..796 CDD:290200 5/24 (21%)
C2H2 Zn finger 787..807 CDD:275368 6/19 (32%)
C2H2 Zn finger 815..835 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.