DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1416 and HCH1

DIOPT Version :9

Sequence 1:NP_610121.2 Gene:CG1416 / 35426 FlyBaseID:FBgn0032961 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_014118.1 Gene:HCH1 / 855440 SGDID:S000005225 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:47/159 - (29%)
Similarity:78/159 - (49%) Gaps:25/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NVNNWHWTEKNATPWSKD----RLHQLFQDFKIGQSDIECAVDSVDKCSGEATVNNRKGKLIFFY 81
            |.|||||.:||..|||||    :|..|......|:|.||  :..|...:|::.|:.||||.|.::
Yeast     5 NPNNWHWVDKNTLPWSKDYLNGKLTSLSTVSSDGKSKIE--LTQVSSITGDSNVSQRKGKPICYF 67

  Fly    82 EWELVLKWSGKLLKNSK-------LIHKGKLTIPNLSEENELADVEITVTIDESNDESETL--KQ 137
            :.:|.:......|..:|       ::..|||.||....:.  :|:.|   :.:..|..:.|  .:
Yeast    68 DLQLSMNVKVTNLDTNKDDEDDDGILADGKLEIPEFMHDE--SDIPI---LSQGFDAFDGLVRSE 127

  Fly   138 FMYNVGRDRVRQQLASYIRELKEEYSKNL 166
            |:     .:|.:.|..|..:|.:|:||::
Yeast   128 FV-----PKVVETLLKYQDDLIKEHSKDI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1416NP_610121.2 COG5580 19..347 CDD:227867 47/159 (30%)
Aha1_N 30..159 CDD:286332 37/141 (26%)
SRPBCC_Aha1 221..346 CDD:176901
HCH1NP_014118.1 COG5580 1..>153 CDD:227867 47/159 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13009
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1975
SonicParanoid 1 1.000 - - X1482
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.