DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Arfgef2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001078964.1 Gene:Arfgef2 / 99371 MGIID:2139354 Length:1792 Species:Mus musculus


Alignment Length:259 Identity:103/259 - (39%)
Similarity:145/259 - (55%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 YINTEQSDNLVILRRPSKQIKD-------ELCEVVS---------EMEALDVPEDCKHSNKDKQ- 398
            |:|......|...|.|.:::.|       ..|.|.|         :....|.||..:...:.|: 
Mouse   589 YVNPNHQATLGQERLPDQEMGDGKGLDMARRCSVTSVESTVSSGTQTAIQDDPEQFEVIKQQKEI 653

  Fly   399 MSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAF 463
            :..|.:.||..||:||::|.|..:|....:|:|.||::.|.|:.|.:|::||:...||::|:.|:
Mouse   654 IEHGIELFNKKPKRGIQFLQEQGMLGAAVEDIAQFLHQEERLDSTQVGEFLGDSTRFNKEVMYAY 718

  Fly   464 VALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRY--CQLNPDIFTNTDTCYVLSFAI 526
            |...||.....|.|||.||..||||||||||||:||.||.||  |.....:|.:.||.|||:::|
Mouse   719 VDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSI 783

  Fly   527 IMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHT 590
            |||.|.||:|.||:|.|.:|:|.||||||:..|||...|.|:|:.|  |..||...:..:  ||
Mouse   784 IMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYDEI--EGKKIAMKETKE--HT 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 87/182 (48%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
Arfgef2NP_001078964.1 DCB, DCB:DCB domain and DCB:HUS domain interaction. /evidence=ECO:0000250 2..224
PLN03076 11..1718 CDD:215560 103/259 (40%)
DCB 28..198 CDD:292830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..294
Sec7_N 377..531 CDD:289549
HUS, DCB:HUS domain interaction. /evidence=ECO:0000250 515..535
Sec7 650..834 CDD:279680 87/185 (47%)
DUF1981 1174..1255 CDD:286414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.