DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and YEL1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_009493.1 Gene:YEL1 / 852219 SGDID:S000000156 Length:687 Species:Saccharomyces cerevisiae


Alignment Length:446 Identity:89/446 - (19%)
Similarity:161/446 - (36%) Gaps:110/446 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SNIHKTNKY-TSKNNNNDSKRESQ-----QSNLCESCRMLLDRNYINTEQSDNLVILRRPSKQIK 371
            :.:.|.:.| .|:...||:..||:     ..::..|.:.:|        ||..:|          
Yeast     6 NEVKKNDTYGVSQKGYNDNFSESEGVLHGSKSMPTSMKNML--------QSPTMV---------- 52

  Fly   372 DELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIE---YLVENRLLRHDPQDVAHF 433
             .:|:::...||.:..:....:........|.:..:....:..:   :|:.:.:|....:||::.
Yeast    53 -NMCDILQNKEAANDEKPVIPTTDTATAGTGTEDISSTQSEETDQNSHLIASEILEGTFKDVSYK 116

  Fly   434 LYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMM 498
            .|          .::||  ||.|..||..||.|.......|::.|.....|.....|||.|||::
Yeast   117 EY----------ANFLG--NDNNNQVLTEFVKLLSPLPSSLLETLFNLSKSIYFIAEAQNIDRIL 169

  Fly   499 ETFAQRY--CQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLP 561
            |..:..:  |..|....:...:|:::.|::::||:.|||....|...:.  .||...|||     
Yeast   170 ECLSIEWIACHPNTHWKSGYKSCHIVLFSLLILNSDLHNNFQVDHKKIK--FSMVAFINN----- 227

  Fly   562 RGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFE 626
              .|.:|.|....|..||                              :.|...|:.:...||  
Yeast   228 --TLRALREENEYEELKI------------------------------YSREHLIIEELSEYY-- 258

  Fly   627 YTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVY----- 686
            .|.::.|   :||...|...|:........:.|:|.|:   :...|.:...|.....|:|     
Yeast   259 KTLNETP---LPLCTESRTSINISDNQSSLKRFSTLGS---REFSTSNLRSVNSNSTTLYSRDGQ 317

  Fly   687 ----RMSAATEED------------QQEWIKRLTQSISHNPFYDILVQRKKKALSK 726
                .|||.:.::            ::.:...|......:.|.|.|:...||:|.:
Yeast   318 VSVREMSAKSNKNFHNNHPMDALYLKESFDDGLITENGSSWFMDDLILISKKSLPR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 45/184 (24%)
PH_GRP1-like 592..710 CDD:269954 21/138 (15%)
PH 596..708 CDD:278594 21/132 (16%)
YEL1NP_009493.1 COG5307 1..687 CDD:227623 89/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1799
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.