DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and GN

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001184991.1 Gene:GN / 837958 AraportID:AT1G13980 Length:1451 Species:Arabidopsis thaliana


Alignment Length:240 Identity:98/240 - (40%)
Similarity:126/240 - (52%) Gaps:31/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 KQMSIGRKKFNMDPKKGIEYLVENRLL--RHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDV 459
            :::.||...||.|||||:|:|....||  :.|||.||.|.....||:|..:||:||..::|...|
plant   563 RRLMIGADHFNRDPKKGLEFLQGTHLLPDKLDPQSVACFFRYTAGLDKNLVGDFLGNHDEFCVQV 627

  Fly   460 LKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSF 524
            |..|....||..:.|..|||.||.:||||||:|||.|::|.|::||...:|:|..|.|...|||:
plant   628 LNEFAGTFDFQYMNLDTALRLFLETFRLPGESQKIQRVLEAFSERYYMQSPEILANKDAALVLSY 692

  Fly   525 AIIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGN---- 585
            :||||||..||..||.|.|.:.||..||.||.|.||||..|..|:.||.....:...:.|.    
plant   693 SIIMLNTDQHNVQVKKKMTEEDFIRNNRHINGGNDLPREFLSELFHSICNNEIRTTPEQGAGFPE 757

  Fly   586 -------DLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLY 623
                   ||||                  ||.|...:||.|:..|
plant   758 MTPSRWIDLMH------------------KSKKTAPYILADSRAY 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 86/181 (48%)
PH_GRP1-like 592..710 CDD:269954 7/32 (22%)
PH 596..708 CDD:278594 7/28 (25%)
GNNP_001184991.1 DCB <93..223 CDD:292830
Sec7_N 313..470 CDD:289549
PLN03076 <351..>1301 CDD:215560 98/240 (41%)
Sec7 562..745 CDD:279680 86/181 (48%)
Mon2_C 1185..>1313 CDD:292823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10663
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.