DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Plekha2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_112547.1 Gene:Plekha2 / 83436 MGIID:1928144 Length:425 Species:Mus musculus


Alignment Length:191 Identity:51/191 - (26%)
Similarity:82/191 - (42%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 PSVKDKPTVDQFISMNRGI-------NNGGDLPRGLLESLYESIRTEPFKIP-----QDDGNDLM 588
            |:::.||.|.....:..|:       .||||...|.....:..:|.....||     ...|..|:
Mouse   136 PTLEKKPQVAYKTEIIGGVVVQTPISQNGGDGQEGCEPGTHAFLRRSQSYIPTSGCRPSTGPPLI 200

  Fly   589 HTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKP 653
                   |.|:..|||...||||||:|.|:|..:.||:...|:||...|||:::        .|.
Mouse   201 -------KSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDREPLRTIPLKDV--------LKT 250

  Fly   654 HCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL---TQSISHNP 711
            |  |.....|..:::    |:..:::....|.| :.|.:.||...||:.:   .|::..:|
Mouse   251 H--ECLVKSGDLLMR----DNLFEIITTSRTFY-VQADSPEDMHSWIEGIGAAVQALKCHP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 11/47 (23%)
PH_GRP1-like 592..710 CDD:269954 35/120 (29%)
PH 596..708 CDD:278594 35/114 (31%)
Plekha2NP_112547.1 PH1_TAPP1_2 1..119 CDD:270089
PH2_TAPP1_2 192..306 CDD:270090 38/135 (28%)
PHA03247 <304..410 CDD:223021 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.