DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and GNL2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_197462.1 Gene:GNL2 / 832081 AraportID:AT5G19610 Length:1375 Species:Arabidopsis thaliana


Alignment Length:288 Identity:108/288 - (37%)
Similarity:156/288 - (54%) Gaps:39/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 NNNNDSKRESQQSNLCESCRMLLDRNYINTEQSDNLVILRRPSKQIKDELCEVVSEMEALDVP-E 388
            |..::..||..:.|                |:.||...:.:||..   |:.|.:...  :|.| |
plant   435 NIADNMDREEDEGN----------------EEDDNNSNVIKPSPV---EIHEYIPFW--IDKPKE 478

  Fly   389 DCK--------HSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRH--DPQDVAHFLYKGEGLNKT 443
            |.:        ...:.::::|....||.|.|||:|||..|.|:..  ||..:|.|.....||:||
plant   479 DFETWVDHIRVRKAQKRKLAIAANHFNRDEKKGLEYLKYNYLVSDPLDPMALASFFRFTPGLDKT 543

  Fly   444 AIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQR-YCQ 507
            .||||||:.::.:..||::|....:||.:.|..|||.||.|||||||:|||:||:|.|::| |.|
plant   544 MIGDYLGDPDELHLSVLRSFTHTFEFTGMNLDTALRTFLESFRLPGESQKIERMIEAFSERFYDQ 608

  Fly   508 LNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESI 572
            .:.|||.:.||.::|.:::|||||..|||.|:.|.|.|:||..||.||.|.|||:..|..|::||
plant   609 QSSDIFASKDTVHILCYSLIMLNTDQHNPQVRRKMTEDEFIRNNRAINAGNDLPKEYLSELFQSI 673

  Fly   573 RTEPFKIPQDDGNDLMHTFFNPDKEGWL 600
            .|..|.:....|...|    ||::  |:
plant   674 ATNAFALSTHSGPVEM----NPNR--WI 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 87/182 (48%)
PH_GRP1-like 592..710 CDD:269954 3/9 (33%)
PH 596..708 CDD:278594 1/5 (20%)
GNL2NP_197462.1 PLN03076 <275..>828 CDD:215560 108/288 (38%)
Sec7 493..678 CDD:396096 87/184 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.