DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and AT5G05710

DIOPT Version :10

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_196190.1 Gene:AT5G05710 / 830455 AraportID:AT5G05710 Length:144 Species:Arabidopsis thaliana


Alignment Length:123 Identity:39/123 - (31%)
Similarity:66/123 - (53%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 NPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYF---EYTTDKEPRGIIPLEN-ISVREIHD-RSK 652
            ||::.|||.|||...|:|:||||:|....|::|   :.|....|||::|:|: ::.:...| .:|
plant    27 NPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSDVTRVSRPRGVVPVESCLTAKGAEDVLNK 91

  Fly   653 PHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHN 710
            .:.|||            .|.:|        |:| ..|.:|:::::||..:.:||..|
plant    92 QNAFEL------------STRNE--------TMY-FIADSEKEKEDWINSIGRSIVQN 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 395..577 CDD:460178
PH_GRP1-like 592..710 CDD:269954 38/121 (31%)
AT5G05710NP_196190.1 PH_AtPH1 30..135 CDD:270095 37/120 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.