DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and AT4G38200

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_195533.2 Gene:AT4G38200 / 829976 AraportID:AT4G38200 Length:1687 Species:Arabidopsis thaliana


Alignment Length:322 Identity:109/322 - (33%)
Similarity:165/322 - (51%) Gaps:58/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 KNSLPPPP-------YIDDMRFIDDSSN-------------SQSESERNSNIHKTNKYTSKNNNN 328
            |.:|.|||       .:.|:.|..:|..             .|..|..:|.:.|:.:..:..||:
plant   440 KTALGPPPGSSTILSPVQDITFRHESVKCLVSIIKAMGTWMDQQLSVGDSLLPKSLENEAPANNH 504

  Fly   329 DSKRESQQSNLCESCRMLLDRNY---INTEQSDNLVILRRPSKQIKDELCEVVSEMEALDVPEDC 390
            .:..|...:.        :|.::   :|.|.||...:.:|.:.:|:                   
plant   505 SNSNEEDGTT--------IDHDFHPDLNPESSDAATLEQRRAYKIE------------------- 542

  Fly   391 KHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDF 455
                :.|.:::    ||..|.||||:|:.::.:.:.|.:|..||....|||.|.|||||||:.||
plant   543 ----RQKGVTL----FNRKPSKGIEFLISSKKVGNSPDEVVSFLRNTTGLNATMIGDYLGEREDF 599

  Fly   456 NEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCY 520
            ...|:.|:|...||..:...:|:|.||..||||||||||||:||.||:|:|:.||:.|::.||.|
plant   600 PMKVMHAYVDSFDFKEMNFGEAIRFFLRGFRLPGEAQKIDRIMEKFAERFCKCNPNSFSSADTAY 664

  Fly   521 VLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQD 582
            ||::::|||||..||..||:|.|...||..||||::|.|||...|.:||:.:.....|:..|
plant   665 VLAYSVIMLNTDAHNIMVKEKMTKADFIRNNRGIDDGKDLPEEYLGALYDQVVINEIKMSSD 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 85/179 (47%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
AT4G38200NP_195533.2 PLN03076 11..1685 CDD:215560 109/322 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.